PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37437.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family ARF
Protein Properties Length: 581aa    MW: 65075.9 Da    PI: 7.8094
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37437.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.35.8e-23121221198
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+k+lt sd++++g +++ +k+a+e+       + + + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +++ l
  KFK37437.1 121 FVKILTASDTSTHGGFSVLRKHATEClpsldmtQ-V-TPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGETGDL 215
                 89****************************9633.3.34459************************************************..3489999 PP

                 EEEEE- CS
          B3  93 vvkvfr 98 
                 +v+v+r
  KFK37437.1 216 RVGVRR 221
                 ***998 PP

2Auxin_resp99.74.1e-33247326183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++tk+ F v+Y+Pr   s+F+++v+k+++a+k+ +s+GmRf+m+fe+e+s+er ++Gt+vg  dl++ +Wp S+WrsL+
  KFK37437.1 247 ASHAVTTKTLFVVFYKPRI--SQFIISVNKYMAAMKNGFSIGMRFRMRFEGEESPERIFTGTIVGSGDLSS-QWPASQWRSLQ 326
                 789***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.27E-39106250IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-37114236IPR015300DNA-binding pseudobarrel domain
CDDcd100172.38E-19120221No hitNo description
PfamPF023624.9E-21121221IPR003340B3 DNA binding domain
PROSITE profilePS5086311.984121223IPR003340B3 DNA binding domain
SMARTSM010194.0E-21121223IPR003340B3 DNA binding domain
PfamPF065071.4E-30247326IPR010525Auxin response factor
PfamPF023091.2E-9473557IPR033389AUX/IAA domain
SuperFamilySSF542774.61E-12485560No hitNo description
PROSITE profilePS5174521.19490577IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MANVDGDFRR SNDQLYMELW KSCAGPLVEV PRYGERVFYF PQGHMEQLVA STNQGVIDQE  60
IPLFNLPPKI LCRVLCVMLK AEHETDEVYA QITLQPEEDQ SEPTSLDPPL VEPVKQKVDS  120
FVKILTASDT STHGGFSVLR KHATECLPSL DMTQVTPTQE LVARDLHGYE WRFKHIFRGQ  180
PRRHLLTTGW STFVTSKRLV AGDAFVFLRG ETGDLRVGVR RLAKQQSTMP ASVISSQSMH  240
LGVLATASHA VTTKTLFVVF YKPRISQFII SVNKYMAAMK NGFSIGMRFR MRFEGEESPE  300
RIFTGTIVGS GDLSSQWPAS QWRSLQIQWD DPSSVQRPNK VSPWEIEHFS PSASTSTPTQ  360
PQSKSKRSRP IGSSSSTTLQ KQTLEITGSP IASNFLNSFP HSHESNPSLK PLFQDLSTNK  420
PLFSSGLQCK KPETPVTSCC RLFGFDLMTA PIPPDKQLVS VDSNNSGSTK CQDPNSSSSP  480
KEQKQQSSTR TRTKVQMQGS AVGRAVDLTL LRSYEELVNE LEKMFEIKGE LSVKDKWAIV  540
FTDDEGDMML VGDDPWKSKK TLLDDEGRIV NLESEQRKVI V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1651234716353Auxin response factor 1
4ldw_A1e-1651234716353Auxin response factor 1
4ldw_B1e-1651234716353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK37437.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2299240.0AK229924.1 Arabidopsis thaliana mRNA for ARF1 family auxin responsive transcription factor like protein, complete cds, clone: RAFL22-28-H22.
GenBankAY6697910.0AY669791.1 Arabidopsis thaliana clone C105346 ARF11 (At2g46530) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020882703.10.0auxin response factor 11
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLA0A087H5N50.0A0A087H5N5_ARAAL; Auxin response factor
STRINGA0A087H5N50.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]