PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KFK34668.1

Organism

Arabis alpina

Taxonomic ID

50452

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis

Family

MIKC_MADS

Protein Properties

Length: 232aa MW: 27313.8 Da PI: 8.6205

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KFK34668.1	genome	MPIPBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	94.2	5.9e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fss++kl+ey+s KFK34668.1 9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYIS 59 79***********************************************86 PP
2	K-box	79.1	1.1e-26	71	169	1	99
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 yq+ s+++++++++e++q+ +kL + ++nL+++++++lGe+L++L+++eL++Le+++e+ k +R++K + l +qie+++kk+k++q+++k+L ++le KFK34668.1 71 YQTVSDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIEELRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELE 169 78899999**************************************************************************************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.142	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.0E-40	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.62E-40	2	80	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.1E-36	3	94	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.1E-29	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.4E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.1E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.1E-29	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	7.2E-15	82	168	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.771	84	174	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010093	Biological Process	specification of floral organ identity
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 232 aa Download sequence Send to blast
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD ARVSIIMFSS SNKLHEYISP 60 NTTTKEIVDL YQTVSDVDVW STQYERMQET KRKLLETNRN LRTQIKQRLG ECLDELDIEE 120 LRRLEDEMEN TFKLVRERKI KSLGNQIETT KKKNKSQQDI QKNLIHELEL RAEDPHYGLV 180 DNGGDYDAVL GYQIEGSRAY ALRYHQNHHH HYPNHSLHAP SASDIITFHL LE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	4e-18	1	61	1	61	MEF2 CHIMERA
6byy_B	4e-18	1	61	1	61	MEF2 CHIMERA
6byy_C	4e-18	1	61	1	61	MEF2 CHIMERA
6byy_D	4e-18	1	61	1	61	MEF2 CHIMERA
6bz1_A	4e-18	1	61	1	61	MEF2 CHIMERA
6bz1_B	4e-18	1	61	1	61	MEF2 CHIMERA
6bz1_C	4e-18	1	61	1	61	MEF2 CHIMERA
6bz1_D	4e-18	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269\|PubMed:18417639, ECO:0000269\|PubMed:8565821, ECO:0000269\|PubMed:9489703}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00077	ChIP-seq	Transfer from AT3G54340	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KFK34668.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269\|PubMed:11283333, ECO:0000269\|PubMed:19783648}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB372087	0.0	AB372087.1 Cardamine sp. SIM-2007 AP3 mRNA for MADS-box transcription factor, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020879680.1	1e-170	floral homeotic protein APETALA 3
Swissprot	P35632	1e-170	AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBL	A0A087GXR6	1e-172	A0A087GXR6_ARAAL; Uncharacterized protein
STRING	A0A087GXR6	1e-173	(Arabis alpina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5261	27	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	1e-132	MIKC_MADS family protein

Publications ? help Back to Top
Furner I,Ellis L,Bakht S,Mirza B,Sheikh M CAUT lines: a novel resource for studies of cell autonomy in Arabidopsis. Plant J., 2008. 53(4): p. 645-60 [PMID:18269574] Jing D, et al. Two ancestral APETALA3 homologs from the basal angiosperm Magnolia wufengensis (Magnoliaceae) can affect flower development of Arabidopsis. Gene, 2014. 537(1): p. 100-7 [PMID:24334124] Zhang Y, et al. A cucumber DELLA homolog CsGAIP may inhibit staminate development through transcriptional repression of B class floral homeotic genes. PLoS ONE, 2014. 9(3): p. e91804 [PMID:24632777] Nakamura Y,Liu YC,Lin YC Floral glycerolipid profiles in homeotic mutants of Arabidopsis thaliana. Biochem. Biophys. Res. Commun., 2014. 450(4): p. 1272-5 [PMID:24984150] Behrend A,Borchert T,Hohe A "The usual suspects"- analysis of transcriptome sequences reveals deviating B gene activity in C. vulgaris bud bloomers. BMC Plant Biol., 2015. 15: p. 8 [PMID:25604890] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Yunus IS, et al. Phosphatidic acid is a major phospholipid class in reproductive organs of Arabidopsis thaliana. Plant Signal Behav, 2015. 10(8): p. e1049790 [PMID:26179579] Sun JJ, et al. CsAP3: A Cucumber Homolog to Arabidopsis APETALA3 with Novel Characteristics. Front Plant Sci, 2016. 7: p. 1181 [PMID:27540391]