PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK33520.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 263aa MW: 30134.9 Da PI: 9.4244 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.7 | 2e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri+nk+nrqvtf+kRrng+lKKA+ELSvLCdae+a++ifs++gklye++s KFK33520.1 9 KRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 86 | 7.6e-29 | 82 | 174 | 8 | 100 |
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++++++ ++ +q++ kLk++++ Lq++qRhllGe+L ++ ++eL+qLe+q+++sl++iRs+K + +l q+++l+ ke++l e+n++Lr+klee KFK33520.1 82 NQSAKDLQEKYQDYLKLKSRVDILQHSQRHLLGEELADMGVNELEQLERQVDTSLRQIRSTKARSMLYQLSDLKTKEEMLLETNRDLRRKLEE 174 3678899***********************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.758 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.7E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.88E-43 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 9.03E-32 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.9E-24 | 86 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.603 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048441 | Biological Process | petal development | ||||
GO:0048442 | Biological Process | sepal development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 263 aa Download sequence Send to blast |
MGRGKVELKR IDNKINRQVT FAKRRNGLLK KAYELSVLCD AEIALLIFSN RGKLYEFCSS 60 PSGMVKTVEK YRKHSYATMD PNQSAKDLQE KYQDYLKLKS RVDILQHSQR HLLGEELADM 120 GVNELEQLER QVDTSLRQIR STKARSMLYQ LSDLKTKEEM LLETNRDLRR KLEESDAALT 180 QSLWGPSSAA EHSHQQQQQQ QQQQQEGMSS YQSNPPNQET GFFKPLQGNV VQMSHNYNPG 240 VTNASNSATT SQNVNGFFPG WMV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 9e-22 | 93 | 172 | 22 | 101 | Developmental protein SEPALLATA 3 |
4ox0_B | 9e-22 | 93 | 172 | 22 | 101 | Developmental protein SEPALLATA 3 |
4ox0_C | 9e-22 | 93 | 172 | 22 | 101 | Developmental protein SEPALLATA 3 |
4ox0_D | 9e-22 | 93 | 172 | 22 | 101 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269|PubMed:15530395, ECO:0000269|PubMed:25183521, ECO:0000269|PubMed:7632923}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00030 | SELEX | Transfer from AT2G03710 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK33520.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | ATU81369 | 0.0 | U81369.1 Arabidopsis thaliana MADS box protein (AGL3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018481405.1 | 1e-165 | PREDICTED: agamous-like MADS-box protein AGL3 | ||||
Refseq | XP_018481406.1 | 1e-165 | PREDICTED: agamous-like MADS-box protein AGL3 | ||||
Refseq | XP_018481407.1 | 1e-165 | PREDICTED: agamous-like MADS-box protein AGL3 | ||||
Swissprot | P29383 | 1e-160 | AGL3_ARATH; Agamous-like MADS-box protein AGL3 | ||||
TrEMBL | A0A087GUG8 | 0.0 | A0A087GUG8_ARAAL; Uncharacterized protein | ||||
STRING | A0A087GUG8 | 0.0 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7135 | 24 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03710.1 | 1e-161 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|