PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK33010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family TALE
Protein Properties Length: 588aa    MW: 67281.7 Da    PI: 7.0185
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK33010.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.4e-093984351954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  KFK33010.1 398 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 435
                 554459******************************88 PP

2BELL99.33.1e-32256327172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e++elqk+kakLls+lee+++rY +y+eq+++ +++Fea++g+g+a++Yt+lA++a+SrhFr +kd ++eqi
  KFK33010.1 256 EFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAAAFEAAVGVGAAEMYTTLASRAMSRHFRRVKDGLVEQI 327
                 679********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075264.2E-40183323IPR006563POX domain
SMARTSM005741.5E-63189325IPR006563POX domain
PROSITE profilePS5007112.017376439IPR001356Homeobox domain
CDDcd000862.48E-10379440No hitNo description
SMARTSM003895.6E-9379443IPR001356Homeobox domain
SuperFamilySSF466892.95E-17380447IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-28382446IPR009057Homeodomain-like
PfamPF059207.7E-18396435IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MARDDQFYGH NHHHQQQHHH QMINQIQGFD ETHHNQTDHH QQQQYNHQIF GSNSNMGMMI  60
DFSKHHQTSG GNDQNQLLED SSSSMRLCNV NNNSFPSEVN DERPQQRPSQ GLSLSLSSSN  120
PTSISLQSFE LRPQQQQQGG YSGKSIHHQN LQHNQMLMMM MNSHHENNHH HQHHNHNHHQ  180
FQIGSSKYLS PAQELLSEFC SLGVKESDEE VMMMKNKRKQ KGKQQEEWDT SNNNNDHDQS  240
ATTSSKKHVP PLHSLEFMEL QKRKAKLLSM LEELKRRYGH YREQMRVAAA AFEAAVGVGA  300
AEMYTTLASR AMSRHFRRVK DGLVEQIQST SQAMGEREED NRAVSIAARG ETPRLRLLDQ  360
ALRQQKSYRQ MSLVDAHPWR PQRGLPERAV TTLRAWLFEH FLHPYPSDVD KHILARQTGL  420
SRSQVSNWFI NARVRLWKPM IEEMYCEETR GEQMEMNTNS MLIDTKPDPN QIMRVEPESL  480
SSIVTKPGHK GTTSSFGSTF DFSLYGNQAV TYAGEGGTRD VSLTLGLQNG GVSLALSPVT  540
AQEGPLYYGR DHIEEGSVQY APSILDDDQA QNLPYRNLMG AQLLHDMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-15385443563Homeobox protein Meis2
3k2a_B3e-15385443563Homeobox protein Meis2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a major role in ovule patterning and in determination of integument identity via its interaction with MADS-box factors. Formation of complex with AG-SEP dimers negatively regulates the carpel identity process and favors the maintenance of ovule identity. BEL1-STM complex maintains the indeterminacy of the inflorescence meristem. Required, with SPL, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). {ECO:0000269|PubMed:12244239, ECO:0000269|PubMed:17693535, ECO:0000269|PubMed:22786869}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK33010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528660.0AK352866.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-O06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405354.10.0homeobox protein BEL1 homolog
SwissprotQ388970.0BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A087GT080.0A0A087GT08_ARAAL; Uncharacterized protein
STRINGA0A087GT080.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58662639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.10.0TALE family protein
Publications ? help Back to Top
  1. Yamada T,Sasaki Y,Hashimoto K,Nakajima K,Gasser CS
    CORONA, PHABULOSA and PHAVOLUTA collaborate with BELL1 to confine WUSCHEL expression to the nucellus in Arabidopsis ovules.
    Development, 2016. 143(3): p. 422-6
    [PMID:26700684]
  2. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]