PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK32175.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family TALE
Protein Properties Length: 384aa    MW: 44249.1 Da    PI: 6.5116
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK32175.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093093442055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  KFK32175.1 309 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 344
                 5679*****************************885 PP

2ELK35.91.6e-12264285122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++Ll+KYsgyL+sLkqE+s
  KFK32175.1 264 ELKNHLLKKYSGYLSSLKQELS 285
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-22120164IPR005540KNOX1
PfamPF037904.0E-22121162IPR005540KNOX1
SMARTSM012565.4E-31169220IPR005541KNOX2
PfamPF037915.5E-26174219IPR005541KNOX2
PfamPF037897.6E-10264285IPR005539ELK domain
SMARTSM011881.0E-6264285IPR005539ELK domain
PROSITE profilePS5121311.243264284IPR005539ELK domain
PROSITE profilePS5007113.021284347IPR001356Homeobox domain
SuperFamilySSF466891.54E-19285359IPR009057Homeodomain-like
SMARTSM003894.0E-13286351IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-27289350IPR009057Homeodomain-like
CDDcd000862.05E-11296348No hitNo description
PfamPF059201.1E-16304343IPR008422Homeobox KN domain
PROSITE patternPS000270322345IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MEEYQHDSSS TPNRVSFLYS PISSSGKNDN ASDNNNSNYA PGYNNNNNNP QHHQHMLFPQ  60
MSPLIPQTTD NCFRSDHDQP NNPSVKSEAS SSRINHYSML MRAIHSTQEA NNNSNVNDVE  120
AMKAKIIAHP HYSTLLQAYL DCQKIGAPPE VADRITAARQ DFESREQRST SVTSRDPELD  180
QFMEAYCDML VKYREELTRP IQEAMEFIRR IESQLSMLCQ GPIHILNNPD GKSERMGSSD  240
EEQENNSGGE TELPEIDPRA EDRELKNHLL KKYSGYLSSL KQELSKKKKK GKLPKEARQK  300
LLTWWELHYK WPYPSESEKV ALAESTGLDQ KQINNWFINQ RKRHWKPSED MQFMVMDGLQ  360
HPHHHAALYM DGHYMGDGPY RLGP
Functional Description ? help Back to Top
Source Description
UniProtMay play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269|PubMed:11934861, ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:7866029}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK32175.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU141740.0U14174.1 Arabidopsis thaliana clone KNAT1 knotted-like homeobox protein gene, partial cds.
GenBankAY0808340.0AY080834.1 Arabidopsis thaliana putative KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
GenBankAY1139820.0AY113982.1 Arabidopsis thaliana putative KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010421735.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X2
SwissprotP466390.0KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLA0A087GQM30.0A0A087GQM3_ARAAL; Uncharacterized protein
STRINGA0A087GQM30.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65662335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.10.0KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. dela Paz JS, et al.
    Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events.
    PLoS Genet., 2012. 8(12): p. e1003136
    [PMID:23284301]
  2. Liu C, et al.
    Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis.
    J Integr Plant Biol, 2013. 55(8): p. 682-95
    [PMID:23931744]
  3. Liu B, et al.
    NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(17): p. 5345-57
    [PMID:23963677]
  4. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]
  5. Scofield S,Dewitte W,Murray JA
    STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
    Plant Signal Behav, 2018.
    [PMID:24776954]
  6. Lee JE,Lampugnani ER,Bacic A,Golz JF
    SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis.
    Plant J., 2014. 80(1): p. 122-35
    [PMID:25060324]
  7. Rast-Somssich MI, et al.
    Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta.
    Genes Dev., 2015. 29(22): p. 2391-404
    [PMID:26588991]
  8. Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B
    Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering.
    Gene, 2016. 587(2): p. 120-31
    [PMID:27154816]
  9. Li Z, et al.
    Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
    J Integr Plant Biol, 2016. 58(12): p. 959-970
    [PMID:27273574]
  10. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]
  11. Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA
    Nonreciprocal complementation of KNOX gene function in land plants.
    New Phytol., 2017. 216(2): p. 591-604
    [PMID:27886385]
  12. Woerlen N, et al.
    Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root.
    Planta, 2017. 245(6): p. 1079-1090
    [PMID:28204875]
  13. Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD
    A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels.
    PLoS ONE, 2017. 12(5): p. e0177045
    [PMID:28493925]
  14. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  15. Simonini S,Stephenson P,Østergaard L
    A molecular framework controlling style morphology in Brassicaceae.
    Development, 2018.
    [PMID:29440299]
  16. Felipo-Benavent A, et al.
    Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
    Development, 2019.
    [PMID:30389856]