PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Nin-like
Protein Properties Length: 727aa    MW: 80904.8 Da    PI: 7.028
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30440.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.51.3e-28461511252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ek+i+l++l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  KFK30440.1 461 EKDITLDTLRQHFAGSLKDAAKNIGVCPTTLKRICRQHGISRWPSRKIKKV 511
                 89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557812.18E-6223369IPR029016GAF domain-like
Gene3DG3DSA:3.30.450.407.2E-4225332IPR029016GAF domain-like
PROSITE profilePS5151917.166447531IPR003035RWP-RK domain
PfamPF020421.4E-25464511IPR003035RWP-RK domain
SuperFamilySSF542775.05E-20632722No hitNo description
Gene3DG3DSA:3.10.20.2406.1E-20634720No hitNo description
PROSITE profilePS5174524.91637722IPR000270PB1 domain
SMARTSM006661.4E-24637722IPR000270PB1 domain
PfamPF005644.0E-18638721IPR000270PB1 domain
CDDcd064072.69E-39638721No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006107Biological Processoxaloacetate metabolic process
GO:0006108Biological Processmalate metabolic process
GO:0005515Molecular Functionprotein binding
GO:0050152Molecular Functionomega-amidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MIMEESNNSD VVDFPDNFMD QLFWEECWEQ EDEAPSSSSS PSGLKERVTC AMGHLQEVMG  60
ERELLIQLWV PVERGSRRVL STEEQPYSLN PFSQSQSLAF YRDVSAAYSF AAEAGSDQQV  120
GLPGRVFLRR MPEWTPDVRF FRSEEYPRIG YARRYQVRAS LALPLFQGTS GECVAVMEMV  180
TTRQNLEYAS HLHNICNALQ AFDLRSSETS IVPSSLKPLV EDLHTEVATI LQGICVSLGL  240
PLAITWGYKD SCLSALPSAC YAADQNSRGF LAACSEHHLL RGEGITGRAF ATNRQCFASD  300
VAVFSKWSYP LSHYARMFDL HAVLAVPILT RRSHSVHLVL EFFFPRDCLD THTQRLTLNS  360
LVSQLSLRFQ SSPHLMVDNQ QLAEQVSDTA TPLTDHSTGH VVTEETPWIS LTADAKDKKA  420
KQVSVSWESH QGEELKLGGG IGEPSYSSLS LESRKRKSKS EKDITLDTLR QHFAGSLKDA  480
AKNIGVCPTT LKRICRQHGI SRWPSRKIKK VGHSLRKLQV VMDSVQGVQG SLHLASFYSS  540
FPQLQSSSSL PLLNPLQTVN VPPKSPPSSS GSQSSSGSST CCSSEDQQQL GGLHKPALSH  600
PQLLTLSSLQ AEQRPVRVTS SLPPLPSAAT PRKAKDGMKV KAMFGDSAVR MSLHLHWRLT  660
DLRREIAKRF GMDDALISNF SLKYLDDDQE WVLLTCDADL EECIQVYKSS LKETIRILVN  720
HPLSSFL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1452457SRKRKS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK30440.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrate. {ECO:0000269|PubMed:15375205}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431765.10.0PREDICTED: protein NLP3-like
SwissprotQ9SVF10.0NLP3_ARATH; Protein NLP3
TrEMBLA0A087GKN80.0A0A087GKN8_ARAAL; Uncharacterized protein
STRINGA0A087GKN80.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152871718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.10.0Nin-like family protein
Publications ? help Back to Top
  1. Doidy J, et al.
    "Hit-and-Run" transcription: de novo transcription initiated by a transient bZIP1 "hit" persists after the "run".
    BMC Genomics, 2016. 17: p. 92
    [PMID:26843062]