PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30194.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Nin-like
Protein Properties Length: 233aa    MW: 27036.1 Da    PI: 10.231
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30194.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.73.6e-2697146352
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 + +sledlskyF  pi +A++ L+++lTvLK++CR++GI+RWPhRkiksl
  KFK30194.1  97 AGLSLEDLSKYFGVPIVEASRRLNIGLTVLKKKCREFGIPRWPHRKIKSL 146
                 5699********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.17981166IPR003035RWP-RK domain
PfamPF020427.8E-2299146IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
NDLKFISDLK LKKVLKVSDQ ENCSRIRHCN FEVDRVQDCE VDQPKPRKIV LKQDLNRLPD  60
SETEAEESEK DKTEHSESDA KTETMKKQKR TPSEHVAGLS LEDLSKYFGV PIVEASRRLN  120
IGLTVLKKKC REFGIPRWPH RKIKSLDTLI HDLQGEAEKQ KNEAAALAVA KRQKKLETEK  180
INMVKRPFME IQIETKKFRQ DNFKKRHKAS RAKKNQESLV TSSSTFKILD LLT
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK30194.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412085.11e-114protein RKD5
SwissprotO817911e-103RKD5_ARATH; Protein RKD5
TrEMBLA0A087GJZ21e-168A0A087GJZ2_ARAAL; Uncharacterized protein (Fragment)
STRINGA0A087GJZ21e-169(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120492429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-102RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]