PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK28953.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family ARF
Protein Properties Length: 641aa    MW: 72635 Da    PI: 6.4693
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK28953.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.12e-24121222199
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +++el
  KFK28953.1 121 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RGENGEL 215
                 88****************************9643..445569************************************************..449999* PP

                 EEEEE-S CS
          B3  93 vvkvfrk 99 
                 +v+v+r+
  KFK28953.1 216 RVGVRRA 222
                 *****97 PP

2Auxin_resp105.46.6e-35247326183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a ha++t+++F+v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe++ds+err+sGtvvgv+d++p +W++S Wr L+
  KFK28953.1 247 ACHATQTRTMFTVYYKPRT--SQFIISLNKYLEAVSNKFSVGMRFKMRFEGDDSPERRFSGTVVGVKDCSP-HWKESIWRRLE 326
                 6899**************6..9*************************************************.********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-38113250IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.3E-42115236IPR015300DNA-binding pseudobarrel domain
CDDcd100171.21E-20119221No hitNo description
PROSITE profilePS5086312.731121223IPR003340B3 DNA binding domain
SMARTSM010194.6E-24121223IPR003340B3 DNA binding domain
PfamPF023623.6E-22121222IPR003340B3 DNA binding domain
PfamPF065074.4E-31247325IPR010525Auxin response factor
PfamPF023091.2E-8503563IPR033389AUX/IAA domain
SuperFamilySSF542771.96E-12523603No hitNo description
PROSITE profilePS5174526.429527619IPR000270PB1 domain
PfamPF023092.1E-6571615IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MTNRGGDGDG GEEYLYKELW KLCAGPLVEI PQAEERVFYF PQGHMEQLEA STQHDLNTMK  60
PLFDLPPKIL CSVMNVRLQA EKDTDEVYAQ ITLIPEGTQV DEPMSPDLSR PELQRPKVHS  120
FSKVLTASDT STHGGFSVLR KHATECLPPL DMTQQTPTQE LVAEDVHGYQ WKFKHIFRGQ  180
PRRHLLTTGW STFVTSKRLV AGDTFVFLRG ENGELRVGVR RANRQQNSMP SSVISSHSMH  240
LGVLATACHA TQTRTMFTVY YKPRTSQFII SLNKYLEAVS NKFSVGMRFK MRFEGDDSPE  300
RRFSGTVVGV KDCSPHWKES IWRRLEVHWD EPASISRPDK VSPWEIEPFL TSENVPPVVI  360
KNKRPRQVSE VSALDVGITG SNLWSSGLTQ SREFAQSCIT SQRISPQQIY HDATEDFKNS  420
DWLMSSYSVS NMSKDSTLND QMVFPVEQKK PETTTSYRLF GIDLMSSSLA TAEEKTAPVR  480
PINTTKPSPD SNSDPKSEIS KESEEKKQEP AQASPKEVQS KQSSSSRTRT KVQMQGVPVG  540
RAVDLTALNG YSELIDDLEK LFEIKGELRS RNQWEIVFTD DEGDMMLVGD DPWPEFCNMV  600
KRIFIWSKEE VKKMTPGNRL RVLFSEVETT LTATKTDNHS N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-16353499355Auxin response factor 1
4ldw_A1e-16353499355Auxin response factor 1
4ldw_B1e-16353499355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK28953.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0821760.0AF082176.1 Arabidopsis thaliana auxin response factor 9 (ARF9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413488.10.0auxin response factor 9 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A087GGF10.0A0A087GGF1_ARAAL; Auxin response factor
STRINGA0A087GGF10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9