PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK28725.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 191aa MW: 21817.7 Da PI: 8.809 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60 | 5.2e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++l+d+++++G g+W+t ++ g+ R++k+c++rw +yl KFK28725.1 14 KGPWTSEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.3 | 6.5e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr++ eE+e +++++ lG++ W++Ia++++ gRt++++k++w+++ KFK28725.1 67 RGRFSFEEEETIIQLHSFLGNK-WSAIAARLP-GRTDNEIKNFWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 9.2E-27 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.797 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.87E-32 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.8E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.54E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.234 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.4E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-15 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.55E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MGRSPCCEKN GLKKGPWTSE EDQKLIDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY 60 LRPDIKRGRF SFEEEETIIQ LHSFLGNKWS AIAARLPGRT DNEIKNFWNT HIRKKLLRMG 120 IDPVTHNQSF NLANSVLTTP SSSPSPTTLN SSSTTYINSS SCSTEDEMES YCSNLMKFDI 180 PDFLDVNGFI I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-31 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK28725.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519607 | 1e-148 | AY519607.1 Arabidopsis thaliana MYB transcription factor (At4g21440) mRNA, complete cds. | |||
GenBank | BT001235 | 1e-148 | BT001235.1 Arabidopsis thaliana myb-related protein M4 (At4g21440) mRNA, complete cds. | |||
GenBank | X90382 | 1e-148 | X90382.2 Arabidopsis thaliana mRNA for putative transcription factor (MYB102 gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_567626.1 | 2e-92 | MYB-like 102 | ||||
Swissprot | Q9LDR8 | 2e-93 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A087GFS3 | 1e-141 | A0A087GFS3_ARAAL; Uncharacterized protein | ||||
STRING | A0A087GFS3 | 1e-141 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 4e-94 | MYB-like 102 |
Publications ? help Back to Top | |||
---|---|---|---|
|