PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family TALE
Protein Properties Length: 413aa    MW: 45985.1 Da    PI: 6.265
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27790.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.6e-083503832154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  KFK27790.1 350 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 383
                 469*****************************87 PP

2ELK28.92.7e-10304325122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+++++++++E++
  KFK27790.1 304 ELKHELKQGYKEKIVDIREEIL 325
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-19140184IPR005540KNOX1
PfamPF037901.1E-17143183IPR005540KNOX1
SMARTSM012569.8E-29195250IPR005541KNOX2
PfamPF037918.3E-21200249IPR005541KNOX2
PfamPF037899.5E-7304325IPR005539ELK domain
SMARTSM011886.1E-4304325IPR005539ELK domain
PROSITE profilePS512139.969304324IPR005539ELK domain
PROSITE profilePS5007111.726324387IPR001356Homeobox domain
SuperFamilySSF466894.71E-16326390IPR009057Homeodomain-like
SMARTSM003892.4E-11326391IPR001356Homeobox domain
CDDcd000869.89E-12327388No hitNo description
Gene3DG3DSA:1.10.10.603.4E-25331388IPR009057Homeodomain-like
PfamPF059201.1E-17344383IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MAFHHNHLSQ DLSFNHFTDQ HQPPPPQQPP PPPPQQQHFQ ESTPPNWLNT ALLRSDNNFL  60
NLHTTTTTAS SSDSPSSAAA TAAANQWLSR SSSFLQRTGN NSGTDVIDDV TGGAEPINAG  120
ENKNDGGVTA AEGVVSWQNA RHKAEILSHP LYEQLLSAHV ACLRIATPVD QLPRIDAQLA  180
QSQHVVAKYS ALGAGQGLVV DDKELDQFMT HYVLLLCSFK EQLQQHVRVH AMEAVMACWE  240
IEQSLQSLTG VSPGEGCGAT MSDDEDEQVE SDANLFDGSL DVLGFGPLIP TESERSLMER  300
VRQELKHELK QGYKEKIVDI REEILRKRRA GKLPGDTTSV LKAWWQSHSK WPYPTEEDKA  360
RLVQETGLQL KQINNWFINQ RKRNWHSNPS SSTVLKNKRK SNAGDNSGRE RFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12327391872Homeobox protein PKNOX1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK27790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0860910.0AY086091.1 Arabidopsis thaliana clone 21240 mRNA, complete sequence.
GenBankAY1207620.0AY120762.1 Arabidopsis thaliana KNAT3 homeodomain protein (At5g25220) mRNA, complete cds.
GenBankBT0001390.0BT000139.1 Arabidopsis thaliana KNAT3 homeodomain protein (At5g25220) mRNA, complete cds.
GenBankX923920.0X92392.1 A.thaliana mRNA for KNAT3 homeobox protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394770.10.0homeobox protein knotted-1-like 3 isoform X1
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A087GD380.0A0A087GD38_ARAAL; Uncharacterized protein
STRINGA0A087GD380.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.10.0KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]