PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK25847.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Nin-like
Protein Properties Length: 453aa    MW: 50547.7 Da    PI: 4.531
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK25847.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.15.7e-26355405252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 + +++l+dl+kyF+lpi++AA++++vc+TvLK+ CR+ G++RWP+Rkiksl
  KFK25847.1 355 TGKLTLDDLKKYFHLPIEKAAQTMEVCPTVLKKVCRRGGLRRWPYRKIKSL 405
                 5689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.007336427IPR003035RWP-RK domain
PfamPF020425.1E-23357405IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MAGDDDARSP APEDDDDDDQ FHDPYNDFGQ FTEENIQNVM ADPNPNLLDF DVDFNVSQNP  60
PDAPKDSNME IDERILEELS LNIASGDNNS EFESFDDDLY ISWDMFETTS ENEPNNCNVQ  120
GEIGGNENLE CGIGHLATSS LVVGENRTNV AGETTRLEVG TRIFGQTFTN YEVGGPSTRP  180
VPVTPIMHDG ILLCGCCQLL RGLVHTNGLE VMRLDIYGET GSFCHAILET EPFGDSNQSR  240
SQSLVLKHMK LEDVRRFIEN YLSEREANGF QLVHDTDVAL TGFYLAVHAG ANNNQPSRLN  300
MLPPNDVVPL SMAMPNAALN IPSVPLYVGL GDEPPKPAKV RPRRNTPLSA QRLRTGKLTL  360
DDLKKYFHLP IEKAAQTMEV CPTVLKKVCR RGGLRRWPYR KIKSLEKRIA ALRKFALATE  420
VAAIRETAEK EIAKLEEEIK EIRNDAAQYL KKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK25847.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A087G7J50.0A0A087G7J5_ARAAL; Uncharacterized protein
STRINGA0A087G7J50.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-12RWP-RK domain-containing protein