PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK25706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Nin-like
Protein Properties Length: 409aa    MW: 45021.8 Da    PI: 5.0887
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK25706.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK68.21.2e-21941271952
      RWP-RK  19 kdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 +dAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++
  KFK25706.1  94 ADAAKSLGVCPTTLKRICRQHGIMRWPSRKINKV 127
                 69******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.25461147IPR003035RWP-RK domain
PfamPF020421.9E-2086127IPR003035RWP-RK domain
SuperFamilySSF542772.78E-21298394No hitNo description
Gene3DG3DSA:3.10.20.2404.9E-21307388No hitNo description
PROSITE profilePS5174518.052309391IPR000270PB1 domain
SMARTSM006663.2E-21309391IPR000270PB1 domain
PfamPF005641.1E-15310390IPR000270PB1 domain
CDDcd064071.43E-36310390No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MYYKRDEYLR RKHAIDNEVC GSIAIPILEA SGTSCRAVME LVTSKEKPNF DMEMNSVCRA  60
LQAVNLRTSA IPRPQYLSSN QRDALAEIQD VLRADAAKSL GVCPTTLKRI CRQHGIMRWP  120
SRKINKVNRS LRKIQTVLDS VQGVEGGLKF DSATGEFIAI GLHVNYVHLR GQENMAEDAS  180
LDLLGVKSVD NAVKLEEDIT TNEAAPGSLI DINASGQPWG WMAEESGLNG SEGIKNVGNL  240
SSVANADGMD ATFRCSGNIV EPNQSMSCNI SDSSNGSGVV MRGTSSTSME DSNQMRSNNN  300
NSSESVSTTL TVKATYREDT IRFKFEPSVG CPQLYKEVGK RFKLQNGSFL LRYLDDEEEW  360
VMLVIDSDLQ ECLEILYGME KHLVKFLVRD LPAPTGSFAT NDNYLGTGS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK25706.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001318414.11e-164Plant regulator RWP-RK family protein
RefseqNP_001325288.11e-164Plant regulator RWP-RK family protein
RefseqNP_001325289.11e-164Plant regulator RWP-RK family protein
RefseqNP_001325290.11e-164Plant regulator RWP-RK family protein
RefseqNP_001325291.11e-164Plant regulator RWP-RK family protein
RefseqNP_001325294.11e-164Plant regulator RWP-RK family protein
RefseqNP_001325295.11e-164Plant regulator RWP-RK family protein
RefseqNP_001325296.11e-164Plant regulator RWP-RK family protein
SwissprotO228641e-160NLP8_ARATH; Protein NLP8
TrEMBLA0A087G7540.0A0A087G754_ARAAL; Uncharacterized protein
STRINGA0A087G7540.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22992768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.21e-153Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]