PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK24610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family TALE
Protein Properties Length: 589aa    MW: 63463.3 Da    PI: 7.9365
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK24610.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-093774092254
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 ++yp+ +++  LAk++gL+ +qV++WF N R +
  KFK24610.1 377 HPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 409
                 89*****************************87 PP

2BELL110.59.8e-36231299472
        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e+ kkk+kL+s+l+eV+krYkqy+eqlq+v++sFe+vaglg+a+pY++lAlka+S++F+cLk+ai++q+
  KFK24610.1 231 ENGKKKSKLISMLDEVYKRYKQYYEQLQAVMGSFECVAGLGHAAPYATLALKALSKNFKCLKNAITDQL 299
                 889***************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-67170297IPR006563POX domain
PfamPF075266.7E-34175296IPR006563POX domain
CDDcd000862.10E-11353414No hitNo description
SMARTSM003894.0E-9353417IPR001356Homeobox domain
SuperFamilySSF466891.03E-16355420IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-27357417IPR009057Homeodomain-like
PfamPF059201.9E-18370409IPR008422Homeobox KN domain
PROSITE profilePS5007111.645372413IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MADAYEPYHV LQQNRRDKLR IPSLDSHFHF HPPPPSSSGA GGGGVYPLAD SDFLAAGGFH  60
SNNNNHHHQI STNPSYSNFM GFLGGPSSSS STAVAVTGDH SFNAGLSSGD VLVFKPEPLS  120
LSLSSSHPRL AYDLVVPGVV NTGFCRSAGD SAAAAVTIAS RSSGPLGPFT GYASILKGSR  180
FLKPAQMLLD EFCNVGRGIY TDKIFDDDDN SSLLFDPVVE NLCGGSDTGG ENGKKKSKLI  240
SMLDEVYKRY KQYYEQLQAV MGSFECVAGL GHAAPYATLA LKALSKNFKC LKNAITDQLQ  300
FSNNNKIQQQ QCGLLMSSEK QTEAMRFGGS DSSRGLCSPG QRHGFSDHHA PVWRPHRGLP  360
ERAVTVLRAW LFDHFLHPYP TDTDKLMLAK QTGLSRNQVS NWFINARVRV WKPMVEEIHM  420
LETRQTQRSS SSSWREERST TTVFPESNNN NNPSSSTAQQ RPNNPSPVRR ARNDDVHGTT  480
NNNNNNTFVN SGSGGVGFPY GIASSNVPGM SSSTNGGVSL TLGLHHQIGL PEPFPMTTAQ  540
RFGLDGGGSS GGGGGETYGG GGGYEGQNRQ FGRDFIGGSS HQFLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A8e-17359417159Homeobox protein Meis2
5bng_B8e-17359417159Homeobox protein Meis2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate. {ECO:0000269|PubMed:12874117, ECO:0000269|PubMed:12897247, ECO:0000269|PubMed:13678595, ECO:0000269|PubMed:15019989, ECO:0000269|PubMed:15120075, ECO:0000269|PubMed:15155890, ECO:0000269|PubMed:16741748}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK24610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023637653.10.0BEL1-like homeodomain protein 9
SwissprotQ9LZM80.0BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A087G4080.0A0A087G408_ARAAL; Transcription factor qsh-1
STRINGA0A087G4080.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56882746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.10.0TALE family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Pabón-Mora N,Wong GK,Ambrose BA
    Evolution of fruit development genes in flowering plants.
    Front Plant Sci, 2014. 5: p. 300
    [PMID:25018763]
  3. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]
  4. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  5. Bencivenga S,Serrano-Mislata A,Bush M,Fox S,Sablowski R
    Control of Oriented Tissue Growth through Repression of Organ Boundary Genes Promotes Stem Morphogenesis.
    Dev. Cell, 2016. 39(2): p. 198-208
    [PMID:27666746]
  6. Sehra B,Franks RG
    Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development.
    Front Plant Sci, 2017. 8: p. 1712
    [PMID:29085379]
  7. Simonini S,Stephenson P,Østergaard L
    A molecular framework controlling style morphology in Brassicaceae.
    Development, 2018.
    [PMID:29440299]