PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | snap_masked-scaffold01324-abinit-gene-0.21-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 198aa MW: 22869.2 Da PI: 9.597 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.1 | 1.8e-17 | 55 | 99 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 W++ Ed ll +vk++ g+ Wk Ia++++ gRt+ qc ++wqk+l snap_masked-scaffold01324-abinit-gene-0.21-mRNA-1 55 GWSEKEDNLLSALVKKYNGKKWKQIAAHIP-GRTDVQCLHHWQKVL 99 6*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 59.5 | 7.5e-19 | 105 | 151 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+ +++ vk +G ++W++Ia+ ++ gR +kqc++rw+++l snap_masked-scaffold01324-abinit-gene-0.21-mRNA-1 105 KGSWTKEEDDCIIEFVKNYGCKRWSLIAKNLP-GRIGKQCRERWFNHL 151 799*****************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 33.3 | 1.1e-10 | 157 | 189 | 1 | 35 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35 +++WT+eE+ ++ +++++G++ W+ Iar ++ gR snap_masked-scaffold01324-abinit-gene-0.21-mRNA-1 157 KDAWTEEEESVIAYYHHKYGNK-WAQIARFLP-GR 189 689*******************.*********.99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51257 | 7 | 1 | 29 | No hit | No description |
PROSITE profile | PS51294 | 16.188 | 47 | 99 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.1E-16 | 49 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.2E-15 | 52 | 101 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-23 | 55 | 115 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.4E-15 | 55 | 99 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.48E-12 | 56 | 99 | No hit | No description |
PROSITE profile | PS51294 | 29.246 | 100 | 155 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.6E-27 | 102 | 190 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.9E-16 | 104 | 153 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-18 | 105 | 151 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.80E-14 | 107 | 151 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.8E-27 | 116 | 157 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.014 | 156 | 196 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 9.763 | 156 | 198 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.5E-8 | 157 | 189 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-14 | 158 | 193 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.28E-5 | 159 | 189 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MVKVKKEKEE LAANSAKEVQ FASCSLQSCG NCDTPVLRCS VIGRPTGPTR RSRRGWSEKE 60 DNLLSALVKK YNGKKWKQIA AHIPGRTDVQ CLHHWQKVLN PEVVKGSWTK EEDDCIIEFV 120 KNYGCKRWSL IAKNLPGRIG KQCRERWFNH LDPAINKDAW TEEEESVIAY YHHKYGNKWA 180 QIARFLPGRY VSEINVLQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 2e-55 | 56 | 194 | 9 | 147 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-55 | 56 | 194 | 9 | 147 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023904204.1 | 1e-130 | uncharacterized protein LOC112015974 | ||||
Refseq | XP_023904205.1 | 1e-130 | uncharacterized protein LOC112015974 | ||||
Refseq | XP_023904206.1 | 1e-130 | uncharacterized protein LOC112015974 | ||||
Refseq | XP_023904207.1 | 1e-130 | uncharacterized protein LOC112015974 | ||||
Swissprot | Q6R032 | 2e-68 | MB3R5_ARATH; Transcription factor MYB3R-5 | ||||
TrEMBL | A0A2I4FAN3 | 8e-96 | A0A2I4FAN3_JUGRE; uncharacterized protein LOC108997066 isoform X2 | ||||
STRING | XP_010676520.1 | 2e-80 | (Beta vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13301 | 25 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02320.2 | 4e-64 | myb domain protein 3r-5 |
Publications ? help Back to Top | |||
---|---|---|---|
|