PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g047804m | ||||||||
Common Name | CISIN_1g047804mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 82aa MW: 9072.54 Da PI: 8.3305 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 40 | 1.2e-12 | 36 | 74 | 61 | 99 |
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallke 99 + yeA+ r+rdPvyG+vg + +lq+q+++l+aela++++ orange1.1g047804m 36 MDYEANSRIRDPVYGCVGAVCHLQKQVSELQAELAKAQA 74 56*********************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 3.1E-11 | 29 | 73 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
GMSFFLKLLE SFRELQSWVN LATGACRTKR DCKLIMDYEA NSRIRDPVYG CVGAVCHLQK 60 QVSELQAELA KAQAGLAFMQ S* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024952279.1 | 3e-22 | LOB domain-containing protein 1-like | ||||
TrEMBL | A0A067F0N2 | 2e-53 | A0A067F0N2_CITSI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006485927.1 | 3e-20 | (Citrus sinensis) | ||||
STRING | XP_006486862.1 | 3e-20 | (Citrus sinensis) | ||||
STRING | XP_006436215.1 | 3e-20 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1141 | 28 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 4e-18 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g047804m |