 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
orange1.1g037152m |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
| Family |
GATA |
| Protein Properties |
Length: 76aa MW: 8739.19 Da PI: 10.6613 |
| Description |
GATA family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| orange1.1g037152m | genome | ICGC | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GATA | 60.3 | 2.4e-19 | 10 | 44 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+C t +Tp+WR gp g+ktLCnaCG++y++ +l
orange1.1g037152m 10 CSHCETRHTPQWRVGPLGPKTLCNACGVRYKSGRL 44
*******************************9986 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0008270 | Molecular Function | zinc ion binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: In leaves, less expressed in dark than in light. {ECO:0000269|PubMed:12139008}. |
| Publications
? help Back to Top |
- Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Choi D, et al.
iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis.
Mol Plant, 2014. 7(5): p. 792-813
[PMID:24380880] - Li T,Wu XY,Li H,Song JH,Liu JY
A Dual-Function Transcription Factor, AtYY1, Is a Novel Negative Regulator of the Arabidopsis ABA Response Network.
Mol Plant, 2016. 9(5): p. 650-661
[PMID:26961720]
|
