PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g037092m
Common NameCISIN_1g037092mg
Organism
Citrus sinensis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 77aa    MW: 8962.29 Da    PI: 10.4697
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g037092mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.82.9e-09848648
                       HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        eEd l+ ++++  G++ W+ I ++++ gRt+++  +++++ +
  orange1.1g037092m  8 DEEDRLICRLFAISGSR-WSVIGAHLP-GRTDNETNNYYRNTK 48
                       59***************.*********.************975 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.403152IPR017930Myb domain
SMARTSM007175.7E-5250IPR001005SANT/Myb domain
SuperFamilySSF466891.47E-9549IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-12646IPR009057Homeodomain-like
CDDcd001674.29E-6648No hitNo description
PfamPF002491.2E-7847IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MKPWGFPDEE DRLICRLFAI SGSRWSVIGA HLPGRTDNET NNYYRNTKLK RKHEEGGLKV  60
PMKKNLERDL RIVKNH*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates in an adaxial ball-shaped set of cells in three to five cell layers around the L3 layer of the shoot apical meristem (SAM) in youg plantlets. Later, expressed transiently at the center of the boundary between the SAM and developing leaf primordia. In the inflorescence meristem, confined to the axils of flower primordia. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:16473968}.
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, internodes, shoot tips and flowers. {ECO:0000269|PubMed:16461581}.
UniprotTISSUE SPECIFICITY: Mostly expressed in roots. Also present in shoot tips and flower buds. {ECO:0000269|PubMed:16461581}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in the regulation of meristematic competence, such as CUC2. Positively regulates axillary meristems (AMs) formation and development, especially at early phases of vegetative growth, probably by specifying a stem cell niche for AM formation. Modulates the negative regulation mediated by gibberellic acid on the timing of developmental phase transitions. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:16473968}.
UniProtTranscription factor that functions as regulator of genes affecting cell wall organization and remodeling. Activates genes related to the primary cell wall and represses genes related to the secondary cell wall and expansins. Required for the regulation of longitudinal cell growth in stems, leaves, petioles, roots, flowers and siliques. {ECO:0000269|PubMed:24563287}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By a shift from short days to long days, in the axils of primordia on the elongating stem. {ECO:0000269|PubMed:16461581}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015380805.14e-32transcription factor MYB34-like
SwissprotF4JSU03e-13MYB87_ARATH; Transcription factor MYB87
SwissprotQ9FG683e-13RAX1_ARATH; Transcription factor RAX1
TrEMBLA0A067FIH88e-50A0A067FIH8_CITSI; Uncharacterized protein
STRINGPavir.Bb01783.1.p6e-15(Panicum virgatum)
STRINGTraes_5BL_C1D4586B1.25e-15(Triticum aestivum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.19e-16myb domain protein 68
Publications ? help Back to Top
  1. Schnaubelt D,Schulz P,Hannah MA,Yocgo RE,Foyer CH
    A phenomics approach to the analysis of the influence of glutathione on leaf area and abiotic stress tolerance in Arabidopsis thaliana.
    Front Plant Sci, 2013. 4: p. 416
    [PMID:24204368]
  2. Fujiwara S, et al.
    Chimeric repressor analysis identifies MYB87 as a possible regulator of morphogenesis via cell wall organization and remodeling in Arabidopsis.
    Biotechnol. Lett., 2014. 36(5): p. 1049-57
    [PMID:24563287]
  3. Guo D, et al.
    The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis.
    Plant Cell, 2015. 27(11): p. 3112-27
    [PMID:26578700]
  4. Yu YT, et al.
    Overexpression of the MYB37 transcription factor enhances abscisic acid sensitivity, and improves both drought tolerance and seed productivity in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 90(3): p. 267-79
    [PMID:26646286]