![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g028767m | ||||||||
Common Name | CISIN_1g019036mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 205aa MW: 22115.5 Da PI: 10.4859 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 103.3 | 2.1e-32 | 31 | 87 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy +Il+RRq+Rak+e ekkl +k rkpylheSRh+hA+rR+RgsgGrF orange1.1g028767m 31 QEPVYVNAKQYMGILRRRQARAKAELEKKL-IKVRKPYLHESRHQHAMRRARGSGGRF 87 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.6E-35 | 29 | 90 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.698 | 30 | 90 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.8E-28 | 32 | 87 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 5.8E-24 | 33 | 55 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 35 | 55 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 5.8E-24 | 64 | 87 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0055046 | Biological Process | microgametogenesis | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 205 aa Download sequence Send to blast |
MMAAYGHQPV GYPQFVGMPH ARMPLPLEMA QEPVYVNAKQ YMGILRRRQA RAKAELEKKL 60 IKVRKPYLHE SRHQHAMRRA RGSGGRFAKK TDDASKGNSE KKGGGSGIRP SLSGSSSGSE 120 PVPSDSAETW NSSASQQDVG GSQAHNMHEA RNHANANGGY QNHGLQASTY HSHLGDRGET 180 GDCSGKQWGS ISSNQASQRP LAIQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 4e-19 | 31 | 87 | 2 | 58 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.6525 | 0.0 | callus| flower| fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in inflorescence, stems, flowers and siliques. {ECO:0000269|PubMed:11867211}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006446125.1 | 1e-148 | nuclear transcription factor Y subunit A-1 isoform X1 | ||||
Refseq | XP_006446126.1 | 1e-148 | nuclear transcription factor Y subunit A-1 isoform X1 | ||||
Refseq | XP_006446127.1 | 1e-148 | nuclear transcription factor Y subunit A-1 isoform X1 | ||||
Refseq | XP_006446128.1 | 1e-148 | nuclear transcription factor Y subunit A-1 isoform X1 | ||||
Refseq | XP_006470619.1 | 1e-148 | nuclear transcription factor Y subunit A-1 | ||||
Refseq | XP_006470620.1 | 1e-148 | nuclear transcription factor Y subunit A-1 | ||||
Refseq | XP_006470621.1 | 1e-148 | nuclear transcription factor Y subunit A-1 | ||||
Refseq | XP_006470622.1 | 1e-148 | nuclear transcription factor Y subunit A-1 | ||||
Swissprot | Q945M9 | 2e-58 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
TrEMBL | A0A067FDI1 | 1e-148 | A0A067FDI1_CITSI; Uncharacterized protein | ||||
STRING | XP_006470619.1 | 1e-148 | (Citrus sinensis) | ||||
STRING | XP_006446125.1 | 1e-148 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20910.1 | 2e-55 | nuclear factor Y, subunit A9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g028767m |
Publications ? help Back to Top | |||
---|---|---|---|
|