PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna35012.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 64aa MW: 7325.26 Da PI: 7.5143 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 47.8 | 4.6e-15 | 8 | 58 | 1 | 51 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51 lp+G+rF+P+de l+++yL+kk ++++ e++ vi+e+d++k+eP+dLp ++ mrna35012.1-v1.0-hybrid 8 LPKGCRFQPSDEVLLSHYLQKKNQRQDPEITAVIPEIDVTKHEPRDLPGEY 58 799***************************999**************9544 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.24E-14 | 3 | 58 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 16.68 | 8 | 63 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.0E-5 | 9 | 35 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
MSYGGFSLPK GCRFQPSDEV LLSHYLQKKN QRQDPEITAV IPEIDVTKHE PRDLPGEYQR 60 RPQ* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna35012.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011468877.1 | 2e-31 | PREDICTED: NAC domain-containing protein 4-like isoform X2 | ||||
TrEMBL | A0A2P6SIY7 | 3e-20 | A0A2P6SIY7_ROSCH; Putative transcription factor NAM family | ||||
STRING | XP_004308753.1 | 6e-26 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF16106 | 4 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G33060.1 | 1e-12 | NAC 014 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna35012.1-v1.0-hybrid |