PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID gw1.4.467.1
Common NameCHLNCDRAFT_15671
Organism
Chlorella variabilis NC64A
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family Dof
Protein Properties Length: 54aa    MW: 6246.02 Da    PI: 9.8878
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gw1.4.467.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1084.8e-34153759
       zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                 +cprC+s++tkfCyynny++sqPryfC++C+ryWt+GG+lr+v  G+grrk+k
  gw1.4.467.1  1 PCPRCNSSDTKFCYYNNYNISQPRYFCRTCQRYWTAGGTLRDVAPGAGRRKSK 53
                 5**************************************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088426.729154IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-21153IPR003851Zinc finger, Dof-type
PfamPF027019.1E-31253IPR003851Zinc finger, Dof-type
PROSITE patternPS013610238IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 54 aa     Download sequence    Send to blast
PCPRCNSSDT KFCYYNNYNI SQPRYFCRTC QRYWTAGGTL RDVAPGAGRR KSKS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005850474.13e-33hypothetical protein CHLNCDRAFT_15671, partial
SwissprotQ93ZL56e-26CDF2_ARATH; Cyclic dof factor 2
SwissprotQ9LQX46e-26DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLE1Z7737e-32E1Z773_CHLVA; Uncharacterized protein (Fragment)
STRINGXP_005850474.11e-32(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP46551111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-28cycling DOF factor 2
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]