PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

bZIP

Protein Properties

Length: 158aa MW: 17877.4 Da PI: 9.5842

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00014.33	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	45	2.3e-14	36	94	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+ +NRe+ArrsRqRK++ ++ L v L +eN++ ++l+ ++++ kl+se+ evm_27.model.AmTr_v1.0_scaffold00014.33 36 RKLKRMRSNRESARRSRQRKQKHVDDLIAQVGFLRKENSQILSRLNITTQHYLKLQSEN 94 6789999*************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	1.2E-10	30	86	No hit	No description
SMART	SM00338	2.8E-17	32	96	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.473	34	97	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	4.0E-12	36	94	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	4.02E-12	36	91	No hit	No description
CDD	cd14702	2.52E-17	37	87	No hit	No description
PROSITE pattern	PS00036	0	39	54	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009845	Biological Process	seed germination
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MASNPTTTTT SSGASASTLL QNSGSEEDLQ NVMDQRKLKR MRSNRESARR SRQRKQKHVD 60 DLIAQVGFLR KENSQILSRL NITTQHYLKL QSENLTLRSE VLDLTAKLHS LTNTLHYIEE 120 ISGLVMDIPQ IPDPLLKPWQ LPCINQPIMA SADMFQY*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	37	54	LKRMRSNRESARRSRQRK
2	48	54	RRSRQRK
3	48	55	RRSRQRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269\|PubMed:23461773}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00239	DAP	Transfer from AT1G75390	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006847527.2	1e-113	bZIP transcription factor 53
Swissprot	C0Z2L5	5e-41	BZP44_ARATH; bZIP transcription factor 44
TrEMBL	W1PM17	1e-112	W1PM17_AMBTC; Uncharacterized protein
STRING	ERN09108	1e-113	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP551	16	78

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G62420.1	1e-42	basic region/leucine zipper motif 53

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00014.33

Publications ? help Back to Top
Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]