 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
evm.model.supercontig_3097.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
Family |
GRAS |
Protein Properties |
Length: 109aa MW: 12746.6 Da PI: 9.1227 |
Description |
GRAS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
evm.model.supercontig_3097.1 | genome | ASGPB | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | GRAS | 127.6 | 1.4e-39 | 2 | 107 | 267 | 373 |
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
lf+s++++++r+ +eri+vE+++l+r+ivn+vaceg+er+erhe ++kW++rl++aGF++++ls ++++ +++llr ++ +
evm.model.supercontig_3097.1 2 LFESIDVTMGRDRKERINVEQHCLARDIVNIVACEGKERVERHELFGKWKSRLTMAGFRQYSLSPYVNSAIRSLLRYYS-E 81
8***************************************************************************999.6 PP
GRAS 348 gyrveeesgslvlgWkdrpLvsvSaW 373
y++ee++g+++lgWkdr+L+s+SaW
evm.model.supercontig_3097.1 82 HYKLEEKDGAMLLGWKDRNLISASAW 107
6************************* PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}. |