PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_127.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 250aa MW: 28562.6 Da PI: 6.9586 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 79.6 | 3.7e-25 | 199 | 248 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQ evm.model.supercontig_127.10 199 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVDKLTRENVASHLQ 248 79*******************.***************************** PP | |||||||
2 | Response_reg | 78.4 | 2.4e-26 | 20 | 128 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEES CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvta 79 vl vdD+p+ + ll+++l++ +y +v+ ++++ +al++l+e++ +Dl++ D++mp+mdG++ll+ e++lp+i+++a evm.model.supercontig_127.10 20 VLAVDDNPTCLLLLETLLRRCQY-HVTKTTQAIKALKMLRENKdkFDLVISDVDMPDMDGFKLLELVGL-EMDLPVIMLSA 98 799********************.***************888888*******************87754.558******** PP TTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 80 hgeeedalealkaGakdflsKpfdpeelvk 109 +g+ +++ + + Ga d+l Kp+ +eel + evm.model.supercontig_127.10 99 YGDTKLVMKGITHGACDYLLKPVRIEELKN 128 ***************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF036392 | 5.2E-146 | 1 | 249 | IPR017053 | Response regulator B-type, plant |
Gene3D | G3DSA:3.40.50.2300 | 2.1E-42 | 17 | 152 | No hit | No description |
SuperFamily | SSF52172 | 2.13E-36 | 17 | 147 | IPR011006 | CheY-like superfamily |
SMART | SM00448 | 5.5E-31 | 18 | 130 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS50110 | 42.461 | 19 | 134 | IPR001789 | Signal transduction response regulator, receiver domain |
Pfam | PF00072 | 8.8E-24 | 20 | 128 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 1.66E-22 | 21 | 133 | No hit | No description |
PROSITE profile | PS51294 | 12.946 | 196 | 249 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.4E-16 | 196 | 248 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.3E-25 | 197 | 248 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.7E-22 | 199 | 248 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.5E-5 | 201 | 248 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MTVEREIGEQ RDQFPVGMRV LAVDDNPTCL LLLETLLRRC QYHVTKTTQA IKALKMLREN 60 KDKFDLVISD VDMPDMDGFK LLELVGLEMD LPVIMLSAYG DTKLVMKGIT HGACDYLLKP 120 VRIEELKNIW QHVVRRKTES KDRNNSNHQD RSRSGNGEAA SRISDQHGKL NKKRKDQNED 180 EDEERDDGHD NEDPSTQKKP RVVWSVELHR KFVAAVNQLG IDKAVPKKIL DLMNVDKLTR 240 ENVASHLQA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 2e-23 | 195 | 248 | 1 | 54 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). Functions as a response regulator in response to cytokinins (PubMed:22383541). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:22383541}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_127.10 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM458594 | 5e-32 | AM458594.2 Vitis vinifera contig VV78X201737.11, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021890650.1 | 0.0 | two-component response regulator ARR12-like isoform X1 | ||||
Swissprot | Q5SML5 | 1e-116 | ORR22_ORYSJ; Two-component response regulator ORR22 | ||||
TrEMBL | A0A1Q3AWN0 | 1e-135 | A0A1Q3AWN0_CEPFO; Response_reg domain-containing protein/Myb_DNA-binding domain-containing protein (Fragment) | ||||
STRING | evm.model.supercontig_127.10 | 0.0 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1981 | 28 | 79 | Representative plant | OGRP292 | 17 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G25180.1 | 1e-97 | response regulator 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_127.10 |
Publications ? help Back to Top | |||
---|---|---|---|
|