PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_21320_iso_3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 115aa MW: 13268.8 Da PI: 8.7816 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.8 | 2.4e-41 | 32 | 108 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrr 74 +Cqve+C+ l+eak yhrrhkvCe+hskapvv +sg+ qrfCqqCsrfh+lsefDe+krsCrrrLa+hnerrr cra_locus_21320_iso_3_len_941_ver_3 32 CCQVEDCQISLKEAKPYHRRHKVCEHHSKAPVVQMSGHPQRFCQQCSRFHDLSEFDEAKRSCRRRLAGHNERRR 105 6************************************************************************* PP S-- CS SBP 75 kkq 77 k++ cra_locus_21320_iso_3_len_941_ver_3 106 KSS 108 *97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 7.2E-34 | 26 | 94 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.676 | 30 | 107 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.06E-38 | 31 | 112 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.0E-33 | 33 | 106 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
DEDVEEENNK KKRALTLSGR RVTCAAGSTQ PCCQVEDCQI SLKEAKPYHR RHKVCEHHSK 60 APVVQMSGHP QRFCQQCSRF HDLSEFDEAK RSCRRRLAGH NERRRKSSYD SLGEG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 3e-35 | 33 | 106 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027159682.1 | 3e-56 | squamosa promoter-binding protein 1 | ||||
Swissprot | Q38741 | 8e-49 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A068TTY6 | 5e-54 | A0A068TTY6_COFCA; Squamosa promoter-binding-like protein | ||||
STRING | Solyc02g077920.2.1 | 4e-47 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Publications ? help Back to Top | |||
---|---|---|---|
|