PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc02307.1.g00020.1.sm.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 171aa MW: 18406.3 Da PI: 6.0225 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.8 | 1.8e-54 | 24 | 119 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvep 82 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyvep Zpz_sc02307.1.g00020.1.sm.mk 24 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETIQECVSEFISFVTGEASDKCRKEKRKTVNGDDVCWAFGALGFDDYVEP 104 89******************************************************************************* PP NF-YB 83 lkvylkkyrelegek 97 ++ yl+++re+eg++ Zpz_sc02307.1.g00020.1.sm.mk 105 MRRYLHRFREVEGDR 119 *************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-50 | 19 | 130 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.02E-38 | 26 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-26 | 29 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.3E-16 | 57 | 75 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.3E-16 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 2.3E-16 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MADHLGQPDD DGRRAAGSAA EEIKEQDRLL PIANVGRIMK QILPPNAKIS KEAKETIQEC 60 VSEFISFVTG EASDKCRKEK RKTVNGDDVC WAFGALGFDD YVEPMRRYLH RFREVEGDRA 120 AAAASSRGAG EGPDHHTSGS GAGGAGPSGT GHFMFGAMDR SDNSTSSSRQ F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-44 | 23 | 114 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc02307.1.g00020.1.sm.mk |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU970198 | 1e-131 | EU970198.1 Zea mays clone 342117 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015635864.1 | 9e-77 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_015635872.1 | 9e-77 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | O82248 | 2e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
Swissprot | Q75IZ7 | 4e-55 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0E0JTD0 | 1e-79 | A0A0E0JTD0_ORYPU; Uncharacterized protein | ||||
STRING | OPUNC01G42210.1 | 2e-80 | (Oryza punctata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-56 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|