PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc00553.1.g00040.1.sm.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 109aa MW: 12313 Da PI: 8.2578 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 78.9 | 8e-25 | 38 | 97 | 2 | 61 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl+k+y++++d++++ ++sws ++nsfvv+d++ f + +Lp+yFkh+nf+SFvRQLn+Y+ Zpz_sc00553.1.g00040.1.sm.mk 38 FLTKTYDMIDDPTTDAVVSWSCTNNSFVVWDPHIFGTVLLPRYFKHNNFSSFVRQLNTYE 97 9********************888***********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.6E-26 | 32 | 97 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 5.0E-24 | 34 | 109 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 1.36E-23 | 36 | 97 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 3.6E-16 | 38 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 6.2E-21 | 38 | 97 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 3.6E-16 | 76 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 3.6E-16 | 89 | 101 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MNHRMVNPVK VESQQSLGAA NGHPLPMDGL HDGGPPPFLT KTYDMIDDPT TDAVVSWSCT 60 NNSFVVWDPH IFGTVLLPRY FKHNNFSSFV RQLNTYEKRG HCKADLVKK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 1e-18 | 36 | 99 | 27 | 90 | Heat shock factor protein 1 |
5d5v_B | 1e-18 | 36 | 99 | 27 | 90 | Heat shock factor protein 1 |
5d5v_D | 1e-18 | 36 | 99 | 27 | 90 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE). Involved in heat stress response. {ECO:0000269|PubMed:18064488}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc00553.1.g00040.1.sm.mk |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC092076 | 1e-46 | AC092076.7 Oryza sativa chromosome 3 BAC OSJNBb0021G19 genomic sequence, complete sequence. | |||
GenBank | AK068660 | 1e-46 | AK068660.1 Oryza sativa Japonica Group cDNA clone:J013162K14, full insert sequence. | |||
GenBank | AP014959 | 1e-46 | AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence. | |||
GenBank | CT829361 | 1e-46 | CT829361.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI220A14, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004981438.2 | 6e-56 | heat stress transcription factor A-2e | ||||
Swissprot | Q6F388 | 5e-55 | HFA2E_ORYSJ; Heat stress transcription factor A-2e | ||||
TrEMBL | K4AC79 | 1e-54 | K4AC79_SETIT; Uncharacterized protein | ||||
STRING | Pavir.J04151.1.p | 3e-57 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP308 | 37 | 231 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 3e-38 | heat shock transcription factor A6B |
Publications ? help Back to Top | |||
---|---|---|---|
|