![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc00496.1.g00010.1.sm.mkhc | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 177aa MW: 19497.4 Da PI: 10.7756 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.7 | 8e-33 | 31 | 87 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq+Rak+e ekk+ k+rkpylheSRh+hA+rR+Rg+gGrF Zpz_sc00496.1.g00010.1.sm.mkhc 31 EEPVYVNAKQYHGILRRRQSRAKAELEKKI-VKARKPYLHESRHQHAMRRARGNGGRF 87 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.4E-36 | 29 | 90 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.689 | 30 | 90 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.7E-28 | 32 | 87 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 5.8E-25 | 33 | 55 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 35 | 55 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 5.8E-25 | 64 | 87 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MVGPYGTQPG TQFQLDGLTH SRMPLPLEIS EEPVYVNAKQ YHGILRRRQS RAKAELEKKI 60 VKARKPYLHE SRHQHAMRRA RGNGGRFLNT KKIDNGTPNG KADPKKGNAY TLETGIKCSS 120 IALPSTFCKA VQGWRPEQNA IWVQKPVPIL LVGGAGRPTA SSLSRIGSGP EIYGESL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 4e-23 | 31 | 95 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc00496.1.g00010.1.sm.mkhc |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021304143.1 | 3e-62 | nuclear transcription factor Y subunit A-1-like | ||||
Refseq | XP_021304146.1 | 3e-62 | nuclear transcription factor Y subunit A-1-like | ||||
Swissprot | Q945M9 | 8e-36 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
TrEMBL | A0A1B6QIQ6 | 6e-61 | A0A1B6QIQ6_SORBI; Uncharacterized protein | ||||
STRING | Sb01g011220.2 | 1e-61 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8205 | 36 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20910.1 | 3e-38 | nuclear factor Y, subunit A9 |
Publications ? help Back to Top | |||
---|---|---|---|
|