PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma7g00740.1 | ||||||||
Common Name | ZOSMA_7G00740 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 171aa MW: 19097.4 Da PI: 10.3429 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 118 | 3.6e-37 | 65 | 120 | 4 | 59 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 + l+cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGalrnvPvG+grrk Zosma7g00740.1 65 SGLPCPRCKSRETKFCYFNNYNVNQPRHFCRGCHRYWTAGGALRNVPVGAGRRKTT 120 5689*************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 1.5E-30 | 67 | 119 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.099 | 67 | 121 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 2.0E-24 | 67 | 119 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 69 | 105 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MVDSHVEQAR REQHPQTPTT PTTAPGFKLF GKRILAEAEQ PSTNKNENEN ENSPEKIQPH 60 HTSASGLPCP RCKSRETKFC YFNNYNVNQP RHFCRGCHRY WTAGGALRNV PVGAGRRKTT 120 VSLAPARSGT ETGNPNGVMM DGVVVQQWLM SRDGFPAKRT HVTSFHDRIR * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ009900 | 2e-98 | AJ009900.1 Zostera marina microsatellite DNA, clone ZosmarGA-2. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002266522.2 | 1e-42 | PREDICTED: dof zinc finger protein DOF1.5 | ||||
Swissprot | O22967 | 7e-38 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A0K9NPY6 | 1e-125 | A0A0K9NPY6_ZOSMR; Cyclic dof factor 4 | ||||
STRING | VIT_10s0003g01260.t01 | 5e-42 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6495 | 28 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 3e-38 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma7g00740.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|