PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma3g01340.1 | ||||||||
Common Name | ZOSMA_3G01340 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 167aa MW: 17816.7 Da PI: 5.8181 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.6 | 3.2e-57 | 31 | 127 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdr+lPian+srimkk+lP n+ki+kdaketvqecvsefisfvtseasdkcqrekrktingddllwa+ tlGfe+y++plk+yl+kyre+eg Zosma3g01340.1 31 VREQDRYLPIANISRIMKKALPLNGKIAKDAKETVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMVTLGFEEYIDPLKAYLQKYRETEG 125 69********************************************************************************************* PP NF-YB 96 ek 97 ++ Zosma3g01340.1 126 DS 127 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.3E-55 | 29 | 138 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.05E-40 | 34 | 146 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-27 | 37 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.0E-21 | 65 | 83 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 68 | 84 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.0E-21 | 84 | 102 | No hit | No description |
PRINTS | PR00615 | 2.0E-21 | 103 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MADEPSSPAG GGVGSPESGG GAGGDLSPRN VREQDRYLPI ANISRIMKKA LPLNGKIAKD 60 AKETVQECVS EFISFVTSEA SDKCQREKRK TINGDDLLWA MVTLGFEEYI DPLKAYLQKY 120 RETEGDSKGS GKKDSGAQGG SQPGPSVQNY QQGSFGQGMH HTYSQP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 4e-48 | 30 | 122 | 1 | 93 | NF-YB |
4awl_B | 3e-48 | 30 | 122 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-48 | 30 | 122 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014496345.1 | 4e-79 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_017418856.1 | 4e-79 | PREDICTED: nuclear transcription factor Y subunit B-10 | ||||
Refseq | XP_027927125.1 | 3e-79 | nuclear transcription factor Y subunit B-10 | ||||
Swissprot | Q67XJ2 | 3e-69 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | A0A0K9P622 | 1e-119 | A0A0K9P622_ZOSMR; Nuclear transcription factor Y subunit B-3 | ||||
STRING | XP_007162720.1 | 2e-77 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-64 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma3g01340.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|