PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc13384.1.g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 143aa MW: 15156.9 Da PI: 10.302 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 94.3 | 8.8e-30 | 35 | 93 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+ +gC vkk+ver+ +dp++v++tY g Hnh Zmw_sc13384.1.g00010.1.sm.mk 35 LDDGFRWRKYGKKAVKSSPNPRNYYRCAAEGCGVKKRVERDCDDPSYVVTTYDGVHNHA 93 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.2E-30 | 23 | 93 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.41E-27 | 27 | 93 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.413 | 30 | 95 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.4E-33 | 35 | 94 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.9E-24 | 36 | 92 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MTTTMRMSRA AGTGTGSRPS PSRIGFRTRS KVDVLDDGFR WRKYGKKAVK SSPNPRNYYR 60 CAAEGCGVKK RVERDCDDPS YVVTTYDGVH NHAAGRRQAL APYGAAATSA CAPAGLAAGA 120 PPSDVWGGVQ VHAAAARSSE SSY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-27 | 25 | 92 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-27 | 25 | 92 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004968484.1 | 1e-46 | WRKY transcription factor WRKY24 | ||||
Swissprot | Q93WU9 | 6e-38 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | A0A1E5UKU3 | 7e-48 | A0A1E5UKU3_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J08526.1.p | 9e-49 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Publications ? help Back to Top | |||
---|---|---|---|
|