PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00911.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 92aa    MW: 10390.7 Da    PI: 7.3659
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00911.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH247.1e-0820591554
                                  HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                           HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                                  +i +  ++L++llP+a  +++ ++  a +L+++++YI+sL
  Zmw_sc00911.1.g00180.1.am.mk 20 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSL 59
                                  789999*********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.101.3E-8378IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.683559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474594.58E-91979IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.9E-52059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSSRRSRSRQ SGSSRITEEQ ISDLVSKLQD LLPEARLQSN ARVPSARVLQ ETCNYIRSLH  60
REVDDLSDRL SELLATSDMS SAQEAIIRSL LM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985540.27e-45transcription factor ILI6
SwissprotB8APB51e-42ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR21e-42ILI6_ORYSJ; Transcription factor ILI6
TrEMBLA0A368SV832e-43A0A368SV83_SETIT; Uncharacterized protein
STRINGSi038231m3e-44(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378