 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Zmw_sc00124.1.g00350.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
| Family |
bHLH |
| Protein Properties |
Length: 117aa MW: 13075.7 Da PI: 5.9277 |
| Description |
bHLH family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Zmw_sc00124.1.g00350.1 | genome | ZGD | - |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | HLH | 22.3 | 2.3e-07 | 45 | 84 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
+i + ++L++llP+a +++ ++ a +L++++ YI+sL
Zmw_sc00124.1.g00350.1.am.mkhc 45 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCSYIRSL 84
789999*********889********************99 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}. |
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}. |
