PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015872707.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 120aa MW: 13330.2 Da PI: 8.2113 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 53.8 | 4.4e-17 | 6 | 35 | 26 | 55 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 +AtPkti+++m+vkgLtl+h+kSHLQkYRl XP_015872707.1 6 EATPKTIMRTMGVKGLTLYHLKSHLQKYRL 35 7****************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
TIGRFAMs | TIGR01557 | 1.2E-10 | 6 | 36 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.5E-15 | 6 | 36 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.97E-6 | 6 | 38 | IPR009057 | Homeodomain-like |
Pfam | PF14379 | 6.1E-12 | 83 | 106 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MICIAEATPK TIMRTMGVKG LTLYHLKSHL QKYRLGKQSC KDSTENSKDV GITASCIAES 60 QDTGSSSTSS SRMMAQELND GYQVTEALRV QMEVQRRLHE QLEVSRFCYL FCIAATTNAA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015872707.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015872707.1 | 2e-85 | protein PHR1-LIKE 3-like isoform X1 | ||||
Swissprot | Q8LAJ7 | 9e-52 | PHL3_ARATH; Protein PHR1-LIKE 3 | ||||
TrEMBL | A0A2N9G4L5 | 8e-57 | A0A2N9G4L5_FAGSY; Uncharacterized protein | ||||
TrEMBL | M5Y4K3 | 4e-57 | M5Y4K3_PRUPE; Uncharacterized protein (Fragment) | ||||
STRING | EMJ26760 | 7e-58 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13367 | 21 | 26 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G13640.1 | 3e-50 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|