PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011093616.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 102aa MW: 12097.8 Da PI: 8.6788 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.9 | 1.1e-08 | 34 | 73 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +++eE++++ + +k+ G + W +Ia +++ gR ++++ +w+ XP_011093616.1 34 MSEEEEDIIRRMHKLVGDK-WGLIAGRIP-GRKAEEIERFWL 73 79***************99.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.9E-6 | 30 | 78 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.88E-5 | 33 | 74 | No hit | No description |
Pfam | PF00249 | 6.0E-8 | 34 | 74 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-10 | 35 | 73 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.14E-7 | 35 | 74 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MDNKCRQKHS KTQNSCSCSS CEEVSSMEWE VIKMSEEEED IIRRMHKLVG DKWGLIAGRI 60 PGRKAEEIER FWLMRNKSES FKSNRMRIIS IPLQQQQQQH NS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011093616.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ052701 | 3e-34 | KJ052701.1 Sesamum indicum clone TilSSR_23902 microsatellite Sesame_23902 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011093616.1 | 2e-69 | MYB-like transcription factor ETC3 | ||||
Swissprot | Q8GV05 | 6e-29 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A2G9I9T4 | 1e-31 | A0A2G9I9T4_9LAMI; Uncharacterized protein | ||||
TrEMBL | A0A4D9ATA4 | 1e-31 | A0A4D9ATA4_SALSN; Myb proto-oncogene protein, plant | ||||
STRING | Migut.N01558.1.p | 3e-31 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA11707 | 18 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01060.2 | 2e-25 | CAPRICE-like MYB3 |