PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011091059.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 154aa MW: 17368.5 Da PI: 4.8937 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171.1 | 1.2e-53 | 29 | 124 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefi+fvtseas+kc++e+rkt+ngdd++wa++tlGf+dy++pl yl++yre+eg+ XP_011091059.1 29 NEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFIGFVTSEASEKCRKERRKTVNGDDICWAMGTLGFDDYAAPLMRYLNRYREVEGD 123 69********************************************************************************************9 PP NF-YB 97 k 97 k XP_011091059.1 124 K 124 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.8E-51 | 25 | 138 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.33E-39 | 31 | 138 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.8E-27 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.1E-16 | 62 | 80 | No hit | No description |
PRINTS | PR00615 | 9.1E-16 | 81 | 99 | No hit | No description |
PRINTS | PR00615 | 9.1E-16 | 100 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MSDSNKSLNS PKPIFSLNMV DNSEAGPSNE QDRLLPIANV GRIMKQILPP NAKISKEAKE 60 TMQECVSEFI GFVTSEASEK CRKERRKTVN GDDICWAMGT LGFDDYAAPL MRYLNRYREV 120 EGDKVNQNRA SNSEEMEEIN CFSYTSNKPQ KESG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-43 | 30 | 119 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-43 | 30 | 119 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011091059.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011091059.2 | 3e-98 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 3e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A068VIP2 | 9e-67 | A0A068VIP2_COFCA; Uncharacterized protein | ||||
STRING | cassava4.1_018746m | 2e-66 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-57 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|