PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010938448.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 171aa MW: 19513.2 Da PI: 9.4656 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 152.8 | 6.5e-48 | 33 | 125 | 3 | 95 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 qd++lPianv+rimk++lP nakisk aket+qec+sefisfvt+eas++c++ekrktingdd++ a+ tlG+++y++++k yl +yre + XP_010938448.1 33 GQDHLLPIANVGRIMKQALPDNAKISKRAKETMQECASEFISFVTGEASEQCRKEKRKTINGDDICSAMKTLGLDEYADAMKRYLCRYREHAE 125 69***************************************************************************************9754 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-46 | 30 | 135 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.25E-36 | 34 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-27 | 38 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.1E-15 | 65 | 83 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 68 | 84 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.1E-15 | 84 | 102 | No hit | No description |
PRINTS | PR00615 | 4.1E-15 | 103 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MDGSIDGQPY LRGHDCNVAR AKAGTTSYEC INGQDHLLPI ANVGRIMKQA LPDNAKISKR 60 AKETMQECAS EFISFVTGEA SEQCRKEKRK TINGDDICSA MKTLGLDEYA DAMKRYLCRY 120 REHAEKATSM KRNKPVQINV RNELPVFRSH QYRDRSPSKR HCNVAQERKF L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-40 | 34 | 122 | 4 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-40 | 34 | 122 | 4 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010938448.1 | 1e-127 | transcriptional activator hap3-like | ||||
Swissprot | O82248 | 1e-43 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2H3YBN7 | 1e-109 | A0A2H3YBN7_PHODC; nuclear transcription factor Y subunit B-3-like | ||||
STRING | XP_008796244.1 | 1e-110 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-46 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|