PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010913296.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 148aa MW: 15862.6 Da PI: 4.8628 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.4 | 7.5e-57 | 26 | 121 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdrflPian++rim+k++P+n+ki+kdake+vqecvsefisfvtseasdkcqrekrktingddllwa++tlGfedyveplk+yl+ yre+eg+ XP_010913296.1 26 KEQDRFLPIANIGRIMRKAIPENGKIAKDAKESVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMGTLGFEDYVEPLKLYLQLYREMEGD 120 89********************************************************************************************9 PP NF-YB 97 k 97 + XP_010913296.1 121 S 121 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-52 | 24 | 133 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.17E-39 | 28 | 127 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.8E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 9.8E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 9.8E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MAESGAPGTP ESGHSGDHGG PSGGAKEQDR FLPIANIGRI MRKAIPENGK IAKDAKESVQ 60 ECVSEFISFV TSEASDKCQR EKRKTINGDD LLWAMGTLGF EDYVEPLKLY LQLYREMEGD 120 SKGSRSADQS GKKDGAINGD LGASYSGM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 8e-49 | 26 | 116 | 3 | 93 | NF-YB |
4awl_B | 8e-49 | 26 | 116 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 8e-49 | 26 | 116 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010913296.1 | 1e-106 | nuclear transcription factor Y subunit B-4 isoform X1 | ||||
Swissprot | Q65XK1 | 1e-71 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A2H3Y033 | 2e-89 | A0A2H3Y033_PHODC; nuclear transcription factor Y subunit B-4-like isoform X1 | ||||
STRING | XP_008791402.1 | 9e-89 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 4e-64 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|