PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010910323.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 133aa MW: 14886 Da PI: 10.5306 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105 | 4.1e-33 | 54 | 112 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+ XP_010910323.1 54 LDDGYRWRKYGQKAVKNSTYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGVHNHP 112 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 40 | 112 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.84E-29 | 47 | 113 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.897 | 49 | 114 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.1E-38 | 54 | 113 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.2E-26 | 55 | 112 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MPAGLLQSVG RPGEGEADAT GGGGGVKEKG KGGRTKKVSR PRFAFQTRSP NDILDDGYRW 60 RKYGQKAVKN STYPRSYYRC THHTCNVKKQ VQRLSKDTSI VVTTYEGVHN HPCEKLMEAL 120 SPLLKQIQFL SRF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-25 | 45 | 111 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 6e-25 | 45 | 111 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00317 | DAP | Transfer from AT2G46130 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010910323.2 | 8e-96 | probable WRKY transcription factor 24 | ||||
Swissprot | Q8GY11 | 9e-57 | WRK43_ARATH; Probable WRKY transcription factor 43 | ||||
Swissprot | Q8VWQ4 | 5e-56 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | A0A2H3Y2C7 | 3e-81 | A0A2H3Y2C7_PHODC; probable WRKY transcription factor 75 | ||||
STRING | XP_008792410.1 | 5e-82 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1100 | 38 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46130.1 | 2e-56 | WRKY DNA-binding protein 43 |
Publications ? help Back to Top | |||
---|---|---|---|
|