PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009628180.1

Organism

Nicotiana tomentosiformis

Taxonomic ID

4098

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

NF-YB

Protein Properties

Length: 106aa MW: 11936.5 Da PI: 7.1895

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009628180.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	164	2e-51	11	104	2	95
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +eqdr+lPianv+rimk++lP nakisk+aketvqecvsefi+fvt+eas+kc++e+rkt+ngdd++wal+tlGf+dy ++k +l++yre eg XP_009628180.1 11 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETVQECVSEFIGFVTGEASEKCRKERRKTVNGDDVCWALGTLGFDDYGGAMKRFLHRYRENEG 104 89*****************************************************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	9.6E-47	4	103	IPR009072	Histone-fold
SuperFamily	SSF47113	3.88E-35	13	104	IPR009072	Histone-fold
Pfam	PF00808	1.7E-26	16	80	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.7E-14	44	62	No hit	No description
PRINTS	PR00615	1.7E-14	63	81	No hit	No description
PRINTS	PR00615	1.7E-14	82	100	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MAQNDEGSNS KEQDRLLPIA NVGRIMKQIL PPNAKISKEA KETVQECVSE FIGFVTGEAS 60 EKCRKERRKT VNGDDVCWAL GTLGFDDYGG AMKRFLHRYR ENEGLN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-42	11	101	2	92	Transcription factor HapC (Eurofung)
4g92_B	3e-42	11	101	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016462866.1	3e-72	PREDICTED: nuclear transcription factor Y subunit B-5-like
Swissprot	O82248	1e-53	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A1S3ZF00	6e-71	A0A1S3ZF00_TOBAC; nuclear transcription factor Y subunit B-5-like
STRING	XP_009628180.1	2e-74	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	6e-56	nuclear factor Y, subunit B5

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]