PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009138393.1

Organism

Brassica rapa

Taxonomic ID

3711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

bZIP

Protein Properties

Length: 264aa MW: 29306.4 Da PI: 10.6516

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009138393.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.6	3.7e-15	195	248	5	58
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 +r +r++kNRe+A rsR+RK+a++ eLe kv+ L+aeN +L + ++l+ e+++ XP_009138393.1 195 RRNKRMIKNRESAARSRARKQAYTNELELKVAHLKAENARLMRQQDQLRMEAEN 248 699*********************************************999886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	6.3E-12	191	255	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.461	193	247	IPR004827	Basic-leucine zipper domain
CDD	cd14707	3.02E-25	195	242	No hit	No description
Gene3D	G3DSA:1.20.5.170	2.1E-14	195	247	No hit	No description
Pfam	PF00170	1.2E-12	195	248	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.69E-11	195	245	No hit	No description
PROSITE pattern	PS00036	0	198	213	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 264 aa Download sequence Send to blast
MLFSANHQRN NRVSATSKNK TLNNVSSISS SSSPSHPQDS QSQKKSLVTM EDVWKDINLG 60 SIQSQHPQGN HEPRFGSHNH QNQNPNSIFQ DFLNRPLNQE PTIPTGLTMS SSSNGDTTTV 120 TALLSSPPLA PPATVLSLNS GAGFEFLDNQ DPLVTPKYNL HSHNHLNTSF EALVTPTCFG 180 KKRGQESNGE GSGNRRNKRM IKNRESAARS RARKQAYTNE LELKVAHLKA ENARLMRQQD 240 QLRMEAENQQ PKKNTLQRAS TAPF

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in shoot apex. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980, ECO:0000269\|PubMed:25661797}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009138393.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB105818	4e-91	AB105818.1 Arabidopsis thaliana FD mRNA for bZIP transcription factor, complete cds, cultiva:Columbia.
GenBank	AB105819	4e-91	AB105819.1 Arabidopsis thaliana FD mRNA for bZIP transcription factor, complete cds, cultiva:Landsberg erecta.
GenBank	AB105820	4e-91	AB105820.1 Arabidopsis thaliana FD mRNA for bZIP transcription factor, complete cds, cultiva:Cvi-1.
GenBank	AB105821	4e-91	AB105821.1 Arabidopsis thaliana FD mRNA for bZIP transcription factor, complete cds, cultiva:Nossen.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009138393.1	0.0	PREDICTED: protein FD-like
Refseq	XP_013748856.1	0.0	protein FD
Swissprot	Q84JK2	1e-122	FD_ARATH; Protein FD
TrEMBL	A0A078IB39	1e-179	A0A078IB39_BRANA; BnaAnng08290D protein
TrEMBL	A0A3P6A9V5	1e-179	A0A3P6A9V5_BRACM; Uncharacterized protein
TrEMBL	M4DMK0	1e-179	M4DMK0_BRARP; Uncharacterized protein
STRING	Bra017735.1-P	1e-179	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1934	27	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	1e-104	bZIP family protein

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]