PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi08g12690.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 150aa MW: 16883.2 Da PI: 4.6157 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 127.8 | 3.8e-40 | 1 | 72 | 30 | 101 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101 +kadedv+misaeaPv++++ace+fileltlrsw+h+eenkr+tl+k+diaaa+trtdifdflvdivpr++ Vradi08g12690.1 1 MKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRKTLQKNDIAAAITRTDIFDFLVDIVPREDY 72 9********************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 2.8E-15 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 6.04E-24 | 1 | 69 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 6.1E-31 | 1 | 69 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MKADEDVRMI SAEAPVIFAR ACEMFILELT LRSWNHTEEN KRKTLQKNDI AAAITRTDIF 60 DFLVDIVPRE DYKDEVLASM PRGAVPVTAP PEALPYCYMP PQHAQVGAAG VMMSNKPVMD 120 PYAQQSHQYN MAQQMWPQPP EQQQSSSDQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 2e-44 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}. | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi08g12690.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 0.0 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027933942.1 | 1e-108 | nuclear transcription factor Y subunit C-3-like | ||||
Swissprot | Q8L4B2 | 1e-58 | NFYC9_ARATH; Nuclear transcription factor Y subunit C-9 | ||||
Swissprot | Q9ZVL3 | 7e-59 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
TrEMBL | A0A4D6N0P9 | 1e-106 | A0A4D6N0P9_VIGUN; Nuclear transcription factor Y | ||||
STRING | XP_007144748.1 | 2e-99 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1257 | 34 | 108 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08970.4 | 2e-60 | nuclear factor Y, subunit C9 |