PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi07g25040.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 206aa MW: 23739.2 Da PI: 8.4628 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 75.1 | 5.5e-24 | 49 | 97 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ie +sn+qvtfskRr+g++KKA+EL++LC++++a+i+fs+ kl+ + Vradi07g25040.1 49 KKIEKSSNKQVTFSKRRTGLFKKASELCILCNVNIAIIVFSPAEKLFCF 97 68*******************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.1E-32 | 41 | 100 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 25.707 | 41 | 101 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.37E-28 | 42 | 114 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.6E-21 | 43 | 63 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-23 | 50 | 97 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.6E-21 | 63 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.6E-21 | 78 | 99 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MHESSEAKYS LGMENPSFPL GMNNHSFSSD IDAFKQQKKK AGRKKIEIKK IEKSSNKQVT 60 FSKRRTGLFK KASELCILCN VNIAIIVFSP AEKLFCFGHP DFDGIVESYL KGSKVFDPPE 120 SRERSSVSYE ECNKQYEEAM KNLELEKKNL RETETLVNKG CNRRWWEDPI DQMSQSELEQ 180 FMVSVYELRR KLAERGGELL MQSMI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3kov_B | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3kov_I | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3kov_J | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3p57_A | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3p57_B | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3p57_C | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3p57_D | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3p57_I | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
3p57_J | 3e-18 | 42 | 127 | 1 | 83 | Myocyte-specific enhancer factor 2A |
5f28_A | 3e-18 | 42 | 127 | 2 | 84 | MEF2C |
5f28_B | 3e-18 | 42 | 127 | 2 | 84 | MEF2C |
5f28_C | 3e-18 | 42 | 127 | 2 | 84 | MEF2C |
5f28_D | 3e-18 | 42 | 127 | 2 | 84 | MEF2C |
6c9l_A | 4e-18 | 42 | 127 | 2 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-18 | 42 | 127 | 2 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-18 | 42 | 127 | 2 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-18 | 42 | 127 | 2 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-18 | 42 | 127 | 2 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-18 | 42 | 127 | 2 | 84 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi07g25040.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014506740.1 | 1e-141 | agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A1S3UL67 | 1e-140 | A0A1S3UL67_VIGRR; agamous-like MADS-box protein AGL62 | ||||
STRING | XP_007154305.1 | 7e-96 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF128 | 33 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 2e-27 | AGAMOUS-like 62 |