PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0158s00260.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 91aa MW: 10192.9 Da PI: 10.1606 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 99.9 | 2.5e-31 | 6 | 73 | 1 | 68 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAear 68 +Ca+Ck+lrr+C+k+C++apyfp+++p+kfa+vhk+FGasnv+k+l++l ++r da+sslvyeA+ar Vradi0158s00260.1 6 PCASCKLLRRRCSKECIFAPYFPSDDPRKFAIVHKVFGASNVSKMLQELGVDQRADAVSSLVYEANAR 73 7******************************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 20.015 | 5 | 90 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.1E-30 | 6 | 74 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MGGTSPCASC KLLRRRCSKE CIFAPYFPSD DPRKFAIVHK VFGASNVSKM LQELGVDQRA 60 DAVSSLVYEA NARWLKQRFY AFRCSNKKLP * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 7e-30 | 2 | 73 | 7 | 78 | LOB family transfactor Ramosa2.1 |
5ly0_B | 7e-30 | 2 | 73 | 7 | 78 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0158s00260.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 1e-67 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022632856.1 | 7e-48 | LOB domain-containing protein 12 | ||||
Swissprot | Q8LBW3 | 8e-40 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | A0A3Q0EP48 | 2e-46 | A0A3Q0EP48_VIGRR; LOB domain-containing protein 12 | ||||
STRING | GLYMA18G06530.1 | 2e-44 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2353 | 34 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 4e-42 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|