PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0023s00960.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 222aa MW: 25807.6 Da PI: 7.9272 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 45.2 | 2e-14 | 118 | 148 | 25 | 55 |
G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 + A+Pk++lelm+++gLt++hv SHLQkYR Vradi0023s00960.1 118 HDAVPKKVLELMNMPGLTRNHVGSHLQKYRN 148 469***************************6 PP | |||||||
2 | Response_reg | 26.6 | 3e-10 | 1 | 59 | 49 | 109 |
EESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 49 lDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109 + + mp+mdG+e+l ++++e ++pii+++ ++++ + + +k+G+ d+ Kp ++++l + Vradi0023s00960.1 1 MEVHMPKMDGYEFL--LANQEIDVPIIMMSWDDNKKSIMKSIKLGGCDYWIKPLHEDRLKN 59 6789*********7..8899999**********************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:3.40.50.2300 | 1.9E-16 | 1 | 87 | No hit | No description |
Pfam | PF00072 | 1.4E-7 | 1 | 60 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS50110 | 20.01 | 1 | 65 | IPR001789 | Signal transduction response regulator, receiver domain |
SuperFamily | SSF52172 | 1.85E-13 | 1 | 74 | IPR011006 | CheY-like superfamily |
CDD | cd00156 | 1.47E-9 | 1 | 64 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.3E-14 | 106 | 152 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.97E-10 | 106 | 152 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.9E-11 | 120 | 148 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MEVHMPKMDG YEFLLANQEI DVPIIMMSWD DNKKSIMKSI KLGGCDYWIK PLHEDRLKNM 60 WTHVVRKSMS ENRMRKDHFS GNSEFVSSST LEISRKVDNV GESHSRKKSR MVWTSELHDA 120 VPKKVLELMN MPGLTRNHVG SHLQKYRNTL KRKPQQSATD IPLHNHLHAE EALNMALDHP 180 MPPYTANFVF PQSSETMPNN VSVDTLQEQQ QMQQWMESFF L* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0023s00960.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015040 | 1e-120 | AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014521971.1 | 1e-152 | two-component response regulator ORR21-like | ||||
Swissprot | A2XE31 | 6e-34 | ORR21_ORYSI; Two-component response regulator ORR21 | ||||
Swissprot | Q8H7S7 | 6e-34 | ORR21_ORYSJ; Two-component response regulator ORR21 | ||||
TrEMBL | A0A1S3VUB1 | 1e-150 | A0A1S3VUB1_VIGRR; two-component response regulator ORR21-like | ||||
STRING | XP_007131372.1 | 3e-63 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14524 | 5 | 17 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16110.1 | 1e-34 | response regulator 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|