PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7DS_A07050CB8.1 | ||||||||
Common Name | NFYB-A1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 81aa MW: 9260.53 Da PI: 6.2402 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 123.2 | 1.1e-38 | 1 | 78 | 17 | 94 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 m+++lPa+akis+dake +qecvsefisfvt+ea+++c+ ++rkt+n++d++wal lGf+dyv pl+v+l++ r+ e Traes_7DS_A07050CB8.1 1 MRRALPAHAKISDDAKEAIQECVSEFISFVTGEANERCRMQHRKTVNAEDIVWALNRLGFDDYVVPLSVFLHRMRDPE 78 89*************************************************************************977 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 2.6E-19 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 5.74E-27 | 1 | 78 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.3E-34 | 1 | 78 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.2E-14 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.2E-14 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.2E-14 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MRRALPAHAK ISDDAKEAIQ ECVSEFISFV TGEANERCRM QHRKTVNAED IVWALNRLGF 60 DDYVVPLSVF LHRMRDPEAG T |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-39 | 1 | 76 | 22 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT009029 | 1e-126 | BT009029.1 Triticum aestivum clone wdk3c.pk023.h15:fis, full insert mRNA sequence. | |||
GenBank | KM078734 | 1e-126 | KM078734.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020178161.1 | 3e-55 | nuclear transcription factor Y subunit B-8-like | ||||
Swissprot | Q84W66 | 3e-38 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A0A7LWQ8 | 6e-54 | A0A0A7LWQ8_WHEAT; CCAAT-binding transcription factor A | ||||
TrEMBL | A0A3B6TPF2 | 7e-54 | A0A3B6TPF2_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446Y9J5 | 6e-54 | A0A446Y9J5_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446Y9K7 | 3e-54 | A0A446Y9K7_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446Y9M8 | 2e-54 | A0A446Y9M8_TRITD; Uncharacterized protein | ||||
STRING | Traes_7DS_A07050CB8.1 | 6e-55 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 6e-41 | nuclear factor Y, subunit B6 |