PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7BS_DBAD99848.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 201aa MW: 22659.9 Da PI: 6.945 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 155.1 | 1.2e-48 | 22 | 117 | 1 | 96 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 vreqdr++Pianv+rim+++lPa+akis+dake +qecvsefisfvt+ea+++c+ e+rkt+n++d++wal lGf+dyv pl+v+l+ Traes_7BS_DBAD99848.1 22 VREQDRLMPIANVIRIMRRALPAHAKISDDAKEAIQECVSEFISFVTGEANERCHMEHRKTVNAEDIVWALNRLGFDDYVVPLSVFLH 109 69************************************************************************************** PP NF-YB 89 kyrelege 96 + r+ e++ Traes_7BS_DBAD99848.1 110 RMRDPEAA 117 ***98865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.7E-45 | 18 | 118 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.73E-34 | 25 | 116 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.6E-25 | 29 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.4E-15 | 56 | 74 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.4E-15 | 75 | 93 | No hit | No description |
PRINTS | PR00615 | 7.4E-15 | 94 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MENADVPNGA AAPAPTQATP VVREQDRLMP IANVIRIMRR ALPAHAKISD DAKEAIQECV 60 SEFISFVTGE ANERCHMEHR KTVNAEDIVW ALNRLGFDDY VVPLSVFLHR MRDPEAATGA 120 AXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXRVQ VQNQMQRPVY ASPAPMQVQN 180 QVQRPMYAPP APVQVQMQRG V |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 7e-51 | 21 | 113 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU902785 | 1e-159 | GU902785.1 Triticum monococcum nuclear transcription factor Y subunit B1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020178158.1 | 1e-98 | nuclear transcription factor Y subunit B-8-like | ||||
Swissprot | Q84W66 | 1e-50 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A3B6TCT0 | 3e-97 | A0A3B6TCT0_WHEAT; Uncharacterized protein | ||||
TrEMBL | M8BX70 | 3e-97 | M8BX70_AEGTA; Nuclear transcription factor Y subunit B-6 | ||||
STRING | Traes_7BS_DBAD99848.1 | 1e-111 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 9e-53 | nuclear factor Y, subunit B6 |