PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BL_096916DC5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 100aa    MW: 10944.4 Da    PI: 10.1041
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BL_096916DC5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-072873651
                           HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
                           + rr   N  A r++R++Kka ++ Lee+++ L a Nk+L+k+++ 
  Traes_7BL_096916DC5.1 28 KRRRPSGNQAAVRKYREKKKAHTALLEEEAARLRAMNKELAKKVQD 73
                           45666779*********************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.00122390IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.6E-122691No hitNo description
PfamPF077163.0E-102772IPR004827Basic-leucine zipper domain
CDDcd146860.001582873No hitNo description
SuperFamilySSF579594.19E-63588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
KIAASASSDA GAETPAEFED AHVTSRSKRR RPSGNQAAVR KYREKKKAHT ALLEEEAARL  60
RAMNKELAKK VQDHAALEAE AARLHCLLVD VRGRIEGEIG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3547351e-110AK354735.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1010J17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020163269.12e-44basic leucine zipper 19-like
SwissprotQ8VY766e-27BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A3B6SPF81e-62A0A3B6SPF8_WHEAT; Uncharacterized protein
STRINGTraes_7BL_096916DC5.11e-64(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.14e-12bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  3. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  4. Henriques AR,Farias DDR,Costa de Oliveira A
    Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals.
    Genet. Mol. Res., 2017.
    [PMID:28671251]
  5. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  6. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]