PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_5AS_6F02C9967.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 180aa MW: 19282.2 Da PI: 9.1287

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5AS_6F02C9967.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	28.2	4.2e-09	5	49	8	52
HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 +r NR A r++R++Kka ++ Lee+v +L+a Nk+L k+l++ Traes_5AS_6F02C9967.1 5 KRPSGNRAAVRKYREKKKAHTALLEEEVVQLKALNKQLLKKLQNH 49 55566**********************************999874 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	5.0E-5	1	65	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.25E-7	3	49	No hit	No description
Pfam	PF07716	1.9E-13	3	55	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.6E-11	4	66	No hit	No description
CDD	cd14686	1.94E-11	10	48	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
GASKKRPSGN RAAVRKYREK KKAHTALLEE EVVQLKALNK QLLKKLQNHA ALEAEAARLR 60 CLLVDIRGRI DGEIGTFPYQ RPVKNVDLVS GVDQGGFLGS AQVMNSCDFR CNDQMYCNTG 120 MQMRTMGDDG AMSGQVFGQG TGDIANIQCI GGVKSGFTMP PGCGGMGTLP SGCLPSSEKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020168902.1	1e-116	basic leucine zipper 23-like
Swissprot	Q8VY76	9e-40	BZP19_ARATH; Basic leucine zipper 19
TrEMBL	A0A446SMM1	1e-129	A0A446SMM1_TRITD; Uncharacterized protein
STRING	Traes_5AS_6F02C9967.1	1e-130	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4175	35	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35040.1	2e-25	bZIP family protein

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Azevedo H, et al. Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply. Genom Data, 2016. 7: p. 256-8 [PMID:26981422] Castro PH, et al. Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants. Sci Rep, 2017. 7(1): p. 3806 [PMID:28630437] Henriques AR,Farias DDR,Costa de Oliveira A Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals. Genet. Mol. Res., 2017. [PMID:28671251] Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE F-group bZIPs in barley-a role in Zn deficiency. Plant Cell Environ., 2017. 40(11): p. 2754-2770 [PMID:28763829] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]