PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DS_833AD0EE2.1 | ||||||||
Common Name | NF-YB3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 100aa MW: 11266.7 Da PI: 6.5192 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 154.6 | 1.7e-48 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyv+plk yl+k+re+ege+ Traes_3DS_833AD0EE2.1 1 MKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGER 81 9******************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 5.64E-34 | 1 | 98 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-21 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 1.9E-44 | 1 | 98 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.6E-20 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.6E-20 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.6E-20 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MKKALPANAK ISKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF 60 EDYVDPLKHY LHKFREIEGE RAAATSTSTT PDMPRNNNNA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 8e-38 | 1 | 76 | 22 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU902787 | 1e-167 | GU902787.1 Triticum monococcum nuclear transcription factor Y subunit B3 mRNA, complete cds. | |||
GenBank | JF830784 | 1e-167 | JF830784.1 Triticum aestivum transcription factor CBF/NF-YB/HAP3 (NF-YB3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020175350.1 | 2e-70 | nuclear transcription factor Y subunit B-8-like | ||||
Swissprot | Q75IZ7 | 2e-59 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A453DQN7 | 4e-69 | A0A453DQN7_AEGTS; Uncharacterized protein | ||||
TrEMBL | F8UMZ5 | 4e-69 | F8UMZ5_WHEAT; Transcription factor CBF/NF-YB/HAP3 | ||||
TrEMBL | G0TEQ5 | 4e-69 | G0TEQ5_TRIMO; Nuclear transcription factor Y subunit B3 | ||||
STRING | Traes_3DS_833AD0EE2.1 | 4e-70 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 6e-54 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|