PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DL_20ED2EA4C.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 128aa MW: 14376.4 Da PI: 10.699 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51.2 | 2.7e-16 | 58 | 104 | 5 | 52 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++Lkk+ +el Traes_3DL_20ED2EA4C.1 58 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKKQ-KEL 104 69****************************************65.444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.7E-14 | 54 | 126 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.702 | 56 | 101 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 1.77E-23 | 58 | 107 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.9E-15 | 58 | 103 | No hit | No description |
Pfam | PF00170 | 5.8E-14 | 58 | 102 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.88E-12 | 58 | 104 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 61 | 76 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MPIQFVPQPL NVVGPGASVG SAYSDGQSTS PISPISDSQT PGRKRGVSGD IPNKFVERRQ 60 KRMIKNRESA ARSRARKQAY TNELENKVSR LEEENERLKK QKELNMMLCS VPLPEPKYQL 120 RRTCSAAF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK373919 | 1e-176 | AK373919.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3047H22. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020190745.1 | 9e-89 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2 | ||||
Swissprot | Q9LES3 | 8e-41 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | A0A3B6GVZ4 | 2e-87 | A0A3B6GVZ4_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453FS13 | 2e-87 | A0A453FS13_AEGTS; Uncharacterized protein | ||||
STRING | Traes_3DL_20ED2EA4C.1 | 5e-89 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP9764 | 30 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 3e-43 | ABA-responsive element binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|